KEGG   Rhodobacter sphaeroides 2.4.1: RSP_6178Help
Entry
RSP_6178          CDS       T00284                                 

Gene name
gpFII
Definition
(RefSeq) Putative phage tail tube protein FII
  KO
K06908  uncharacterized protein
Organism
rsp  Rhodobacter sphaeroides 2.4.1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_tube
Motif
Other DBs
NCBI-GeneID: 3722054
NCBI-ProteinID: YP_354858
UniProt: Q3IWX7
Position
2:418664..419161
Genome map
AA seq 165 aa AA seqDB search
MALPRTIRNFNAFVDGVSYFGIVDEGKLPAVKIQTEAHRGAGMDGPIGIDVGMEALASKM
SFSEWVPAIVKKLGRQERFVFRPAMANPSDFGAVPIVATLSGLITVSEPGDLKPGTPSKL
KISMDVRSYRLEIDGELLLDIDLPNAKRVIGGQDQLAEMRRAMGI
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggcccttccgcgcacgatcaggaacttcaacgccttcgtcgacggggtgagctacttc
ggcatcgtcgacgagggcaagctgccagcggtcaagatccagaccgaggcgcatcgcggc
gccggcatggacggcccgatcggcatcgacgtcggcatggaggcgctcgcttccaagatg
tccttctcggaatgggtgcccgccatcgtcaagaagctcggccgtcaggagcgcttcgtg
ttccgcccggcgatggccaacccgtcggacttcggcgccgtgccgatcgtggccaccctt
tcggggctgatcacggtgagcgagccgggcgatctgaagcccggcacgccctcgaagctg
aagatctcgatggatgtgcggagctaccggctggagatcgacggcgagttgctgctcgac
atcgacctgccgaacgcgaagcgggtgatcggcggccaggaccagctggcagagatgcgc
cgcgccatgggtatttaa

DBGET integrated database retrieval system