KEGG   Rhodobacter sphaeroides 2.4.1: RSP_7601Help
Entry
RSP_7601          CDS       T00284                                 

Definition
(RefSeq) phage P2 GpE family protein
Organism
rsp  Rhodobacter sphaeroides 2.4.1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_P2_GpE
Motif
Other DBs
NCBI-GeneID: 17312423
NCBI-ProteinID: YP_008686461
UniProt: U5NMH3
Position
2:419499..419627
Genome map
AA seq 42 aa AA seqDB search
MADIAAVFHWPPQSMDPMSPEELARWWAKARARSAPPDMSEG
NT seq 129 nt NT seq  +upstreamnt  +downstreamnt
atggccgacattgccgccgtcttccactggccgccccagagcatggacccgatgagcccg
gaggagctcgcccgctggtgggcgaaggcccgggctcggtcggcaccccccgacatgagc
gaaggctga

DBGET integrated database retrieval system