KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_0565Help
Entry
Rsph17025_0565    CDS       T00512                                 

Definition
(GenBank) tRNA(Ile)-lysidine synthetase
  KO
K04075  tRNA(Ile)-lysidine synthase [EC:6.3.4.19]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Brite
KEGG Orthology (KO) [BR:rsq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rsq03016]
    Rsph17025_0565
Enzymes [BR:rsq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.19  tRNAIle-lysidine synthase
     Rsph17025_0565
Transfer RNA biogenesis [BR:rsq03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    Rsph17025_0565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP_bind_3 QueC PAPS_reduct
Motif
Other DBs
NCBI-ProteinID: ABP69471
UniProt: A4WQ07
Position
564753..565991
Genome map
AA seq 412 aa AA seqDB search
MPILERFLRGPGLREVRALGLAVSGGGDSMALLHLAAEAGIAARAVTVDHGLRPEAAAEA
LEVGRVCTRLGVPHDILRWEGWDGRGNLMDQARRARLRLISEWARGAGLDAVALGHTRDD
VAETFLMRLARGAGVDGLAAMRAERRAEGMLWLRPLLGIGREELREELRRRGAAWFEDPS
NENRAFDRVRVRQAMQGLAGLGLGPERLAEVAGHLAEVRAALDAQLHEAARTLVRVDRGD
VLMAPGVLDLPDEILRRLLRGAVQWVASAEYGPRGPALARLMRDLRQGKGRTLHGCRLVW
RRDGLRIGREWQAVRDLTAPVGALWDGRWRLQGPPQEDISDQPLEIRALGANGLDRCPGW
RATNMPRASLLASPGVWRGPDLLAAPLAARPNGWVALTDPLRNGDFLSRLSH
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgccgatccttgaacggttcctgaggggcccggggctgcgtgaggtgcgcgccctgggc
ctcgccgtttccggcgggggcgattcgatggcgctcctgcatcttgcggccgaggcgggc
attgcggcccgcgcggtgacggtggatcacgggcttcgccccgaggccgccgccgaggcg
ctcgaggtcggccgcgtctgcacgcgccttggcgtgccgcacgacatcctccgctgggag
ggctgggacggccgcggcaatctgatggaccaggcgcgacgcgcgcggctgcggcttatc
tcggaatgggcgcggggggcgggcctcgatgcggtggcgctgggtcatacgcgggacgat
gtggccgagaccttcctcatgcggctggcgcgcggggcgggggtggacgggcttgccgcc
atgcgggccgagcggcgggccgaggggatgctctggctgcggcccctgctggggatcggg
cgcgaggaactgcgcgaggagctgcgccgccgcggcgcggcctggttcgaggatccgtcc
aacgagaatcgcgccttcgaccgggttcgggtgcggcaggcgatgcaggggcttgccggc
cttggccttggccccgaacgtctggccgaagtcgcggggcatctggccgaggtgcgcgcg
gcgctcgatgcgcaactgcacgaggcggcgcggacactcgtgcgggtggaccgcggggac
gtgctgatggcgcccggcgttctcgatctgcccgacgagatcctgcggaggctgctgcga
ggcgccgttcagtgggtggcatcggcggaatatggcccgcgcggcccggcgctggcgcgg
ctcatgcgggacctgcggcaggggaaggggcggacgctccacggctgccggctggtgtgg
cgacgcgacgggctgcggatcgggcgcgaatggcaggcggtgagggatctgacggccccg
gtgggggcgctctgggacgggcgctggcggctgcaaggtccgccgcaggaagacatttcc
gatcagccgcttgagatccgggccctcggcgccaacggacttgaccgctgccccggctgg
cgtgcgacgaacatgccccgggccagcctgctcgcctcgccgggggtgtggcgggggccg
gatctgctggctgccccgctcgcggcccggccgaacggatgggtcgccctgaccgatccc
ctgcgaaatggcgactttctttcacgactatcgcattga

DBGET integrated database retrieval system