KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_1022Help
Entry
Rsph17025_1022    CDS       T00512                                 

Definition
(GenBank) protoporphyrin IX magnesium-chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq00860  Porphyrin and chlorophyll metabolism
rsq01100  Metabolic pathways
rsq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rsph17025_1022
Enzymes [BR:rsq01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Rsph17025_1022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 Sigma54_activat AAA_16 MCM AAA_22 AAA AAA_29 DUF815 FtsK_SpoIIIE AAA_18
Motif
Other DBs
NCBI-ProteinID: ABP69923
UniProt: A4WRA9
Position
complement(1048574..1049578)
Genome map
AA seq 334 aa AA seqDB search
MKNPFPFSAIVGQEQMKQAMVLTAIDPGIGGVLVFGDRGTGKSTAVRALAALLPLIKAVE
GCPVNSARPEDCPEWAQVSSTTMIERPTPVVDLPLGVTEDRVVGALDIERALTRGEKAFE
PGLLARANRGYLYIDEVNLLEDHIVDLLLDVAQSGENVVEREGLSIRHPARFVLVGSGNP
EEGELRPQLLDRFGLSVEVRSPRDVETRVEVITRRDAYDADHENFMAKWGAEDMQLRGRI
LGARAALPTLKTPNTVLHDCAALCIALGSDGLRGELTLLRAARAQAAFEGAETVGRSHLR
SVATMALSHRLRRDPLDEAGSVTRVERCVAEVLP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccccttccccttctcggccatcgtcggtcaggagcagatgaagcaggccatg
gtgctcactgcgatcgacccgggcatcggcggcgtgctggtgttcggcgatcgcggcacc
ggcaagtccaccgccgtccgtgctctcgcggcgcttctgccgctgatcaaggcggtcgag
ggctgccccgtgaactctgcccggcccgaggattgcccggaatgggcgcaagtctcctcc
accacgatgatcgaacggccgaccccggtggtcgacctgccgctcggcgtgaccgaggac
cgtgtggtgggcgcgctcgacatcgagcgcgccctcacccgcggcgaaaaggcctttgaa
cccggcctgctcgcccgcgccaaccgcggctatctctatatcgacgaggtcaacctgctc
gaagatcacatcgtggacctgctgcttgatgtggcgcagtccggcgagaacgtggtcgag
cgcgagggcctctcgatccgccaccccgcccgtttcgtgctggtgggctcgggcaacccg
gaagaaggcgagctgcgtccgcagcttctggaccgcttcggcctgtcggtcgaggtccgc
tcgccccgcgacgtggagacccgcgtcgaggtcatcacccgccgcgacgcctatgacgcc
gaccatgagaacttcatggcgaaatggggcgccgaggacatgcagctgcgcggccgcatc
cttggtgcacgggcggccctgcccacgctcaagacgccgaacaccgtgctgcacgactgc
gcggcgctctgcatcgcgctgggatcggacggtctgcggggcgaactgacgcttctgcgc
gcggcgcgggcgcaggcggccttcgaaggcgccgagaccgtcggccgcagccatctgcgc
tcggtcgcgacgatggcgctgtcgcaccggctgcggcgcgatccgctggacgaggcaggg
tcggtgacccgcgtcgagcgctgcgtggcggaggttctgccctga

DBGET integrated database retrieval system