KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_1595Help
Entry
Rsph17025_1595    CDS       T00512                                 

Definition
(GenBank) nitrite reductase, copper-containing
  KO
K00368  nitrite reductase (NO-forming) [EC:1.7.2.1]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq00910  Nitrogen metabolism
rsq01100  Metabolic pathways
rsq01120  Microbial metabolism in diverse environments
Module
rsq_M00529  Denitrification, nitrate => nitrogen
Brite
KEGG Orthology (KO) [BR:rsq00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Rsph17025_1595
Enzymes [BR:rsq01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.1  nitrite reductase (NO-forming)
     Rsph17025_1595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cu-oxidase Cu-oxidase_3 Cu-oxidase_2 Copper-bind Metallophos_C
Motif
Other DBs
NCBI-ProteinID: ABP70488
UniProt: Q53239
Structure
PDB: 

Position
1637846..1638970
Genome map
AA seq 374 aa AA seqDB search
MFTRRAALVGAAALASAPLVIRTAGAEEAPAQLASAAPVDLSNLPRVKHTLVPPPFAHAH
EQVAASGPVINEFEMRIIEKEVQLDEDAYLQAMTFDGSIPGPLMIVHEGDYVELTLINPP
ENTMPHNIDFHAATGALGGGGLTLINPGEKVVLRFKATRAGAFVYHCAPGGPMIPWHVVS
GMAGCIMVLPRDGLKDHEGKPVRYDTVYYIGESDHYIPKDEDGTYMRFSDPSEGYEDMVA
VMDTLIPSHIVFNGAVGALTGEGALKAKVGDNVLFVHSQPNRDSRPHLIGGHGDLVWETG
KFHNAPERDLETWFIRGGSAGAALYKFLQPGVYAYVNHNLIEAVHKGATAHVLVEGEWDN
DLMEQVVAPVGLTG
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtttacccgccgcgccgccctcgtgggagccgccgcgctcgcgtcagcgccgctcgtc
atccggacggcaggcgccgaggaagctccggcccagcttgccagtgcagcccccgtcgat
ctcagcaacctgccccgcgtgaagcacacgctcgtgcctccgcccttcgcgcatgcccac
gagcaggtggccgccagcggccccgtcatcaacgaattcgagatgcggatcatcgagaag
gaagtgcagctcgacgaagatgcctacctgcaggcgatgaccttcgacggctcgatcccc
ggcccgctgatgatcgtgcatgagggcgactatgtcgaactcaccctgatcaacccgccc
gagaacaccatgccccacaacatcgacttccacgccgccaccggcgcgctgggaggcggc
gggctcacgctcatcaatccgggcgaaaaggtcgtcctgcggttcaaggccacgcgcgcg
ggcgccttcgtctatcactgcgcccccggcggcccgatgatcccctggcacgtcgtctcg
ggcatggcgggctgcatcatggtgctgccgcgcgacggcctgaaggaccacgagggcaag
ccggtgcgctatgacaccgtctattacatcggcgagagcgaccactacatcccgaaggac
gaggacggcacctacatgcgcttctccgacccgtcggagggctacgaggacatggtcgcg
gtgatggacacgctgatccccagccacatcgtcttcaacggcgcggtgggcgccctgacc
ggcgagggcgcgctgaaggccaaggtgggcgacaacgtcctcttcgtccacagccagccc
aaccgcgactcgcgcccgcacctcatcggcggacacggcgatctcgtctgggaaaccggc
aagttccacaacgcgcccgagcgtgacctcgagacctggttcatccgcggcggctcggcc
ggggccgcgctctacaagttcctccagccgggcgtctacgcctacgtcaaccacaacctg
atcgaggcggtccacaagggcgccacggcgcacgtcctcgtcgagggcgagtgggacaac
gacctgatggaacaggtcgtggcgccggtcggcctcaccggctga

DBGET integrated database retrieval system