KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_2198Help
Entry
Rsph17025_2198    CDS       T00512                                 

Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq00260  Glycine, serine and threonine metabolism
rsq01100  Metabolic pathways
rsq01110  Biosynthesis of secondary metabolites
rsq01120  Microbial metabolism in diverse environments
rsq01130  Biosynthesis of antibiotics
rsq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rsq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rsph17025_2198
Enzymes [BR:rsq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Rsph17025_2198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ABP71088
UniProt: A4WUM4
Position
2228697..2229722
Genome map
AA seq 341 aa AA seqDB search
MFFASDNGSAVAPEVLAALAADPGPAMPYGADPVTAEVTAMIRTLFEAPEAEVALVTSGT
AANALALATLSPPWGAIFCREEAHIEADECNAAEFFSGEAKLVTLPGEQGKLAPETLAAA
LARFAPGDLHAARPAALSLTNVTELGTLYRPAEIAALTAVARTRGLGCHLDGARFANALV
AADASPAEMSWRAGIDILSLGGTKNGLMGVEAVVVFDPARADELRIRRKRAGHLMSKHRY
LALQMRAYLADGLWLRLARHANAAAARLAEGLAALPDVRLVAPAEANLIFADLPQALAHR
ARAAGAVFYDMSREGNRVRVRLVCSWNTSDAEVDAFVAALA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgttctttgcctcggacaatggctcggccgtcgcgccggaggtgctggccgcgctggcg
gccgatccggggccggcgatgccctatggtgcggacccggtgacggcggaggtcaccgcc
atgatccgaaccctcttcgaggcgcccgaggccgaggtcgcgctggtcaccagcggcacg
gccgccaacgcgctggcactcgccaccctcagcccgccctggggcgcgatcttctgccgc
gaggaggcccatatcgaggcggacgagtgcaacgccgccgagttcttctcgggcgaagca
aaactcgtcaccctgcccggcgagcagggcaagctcgctcccgagacgctggccgccgct
ctggcccgcttcgcaccgggcgatctccatgcggcacggcccgccgccctgtcgctgacg
aatgtgaccgagcttggcaccctgtaccgcccggccgagatcgcggccctcaccgccgtg
gcgcggacgcggggcctcggctgccacctcgacggggcgcgctttgccaatgcgctggtg
gcggccgatgcctctccggccgagatgagctggcgggcgggcatcgacatcctgtcgctg
ggtggcaccaagaacgggctgatgggggtcgaggcggtggtggtcttcgaccccgcccgg
gccgacgaactgcgcatccggcgcaagcgtgcgggacatctgatgtcgaagcaccgctat
ctcgcgctgcagatgcgggcctatctggccgacgggctgtggctgcggctcgcccgccac
gccaatgcggcggcggcccggctggcggaggggctggcggccctgcccgacgtgcgcctc
gtggccccggccgaggccaacctgatcttcgccgacctgccccaggccctcgcccaccgc
gcccgcgccgccggtgcggtgttctacgacatgagccgagaggggaaccgcgtgcgggtg
cggctcgtctgttcctggaacacgtccgacgccgaggtcgatgccttcgtcgcggccctc
gcctga

DBGET integrated database retrieval system