KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_2323Help
Entry
Rsph17025_2323    CDS       T00512                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Brite
KEGG Orthology (KO) [BR:rsq00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Rsph17025_2323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Vma12
Motif
Other DBs
NCBI-ProteinID: ABP71212
UniProt: A4WUZ8
Position
2367534..2369048
Genome map
AA seq 504 aa AA seqDB search
MTLPPTRPADTTPDGASPSINQWKTLDKDLKRIVQLEEAGQFVGRPLISIGVALVFIVVA
GVAASLITGGTPNSLVIVAAAAFGAYMAINIGANDVANNMGPAVGANALTLTGALAIAAI
FETAGALIAGGDVVSTISGGIVDPASVAEAGIFVWAMMAALIAAAVWLNIATAIGAPVST
THSIVGGVMGAGIMAAGMSAVNWPVMGQIAASWVISPVLGGVFAALFLAFIKNRLLDAED
KIAAARLWVPLLIGVMAAAFATYLALKGLRKVMEVQLPAAVMIGLAIGVATVFLTRPLVR
RQSEGMENRKKSLKKLFGLPLVVSAALLSFAHGANDVANAVGPLAAIVHAVSNGDTAARV
AIPLWVMIIGAGGISFGLVLFGPKLIRMVGSEITKLNPMRAYCVALSAAITVIVASGLGL
PVSSTHIAVGGIFGVGFYREWQAERRSRALGLIKGKPLPPDERKRRKLVRRAHFLTIGAA
WVVTVPATALLSGAVFVALRTFAG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcccaccgacccgtcctgccgatacgacgcccgacggcgcgagcccctcgatc
aaccagtggaagacgctcgacaaggacctgaagcggatcgtccagctggaggaggccggc
cagttcgtcggccgccccctgatctcgatcggggtcgcgctcgtcttcatcgtggtggcg
ggcgtggcggcctcgctgatcaccggagggacgcccaactcgctggtgatcgtcgcggcc
gcggccttcggcgcctacatggcgatcaacatcggcgccaacgacgtggccaacaacatg
ggccccgcggtcggcgccaatgccctgaccttgaccggggcgctcgccatcgccgccatc
ttcgagacggcgggcgcgctgatcgcgggcggcgatgtggtgagcaccatctcgggcggg
atcgtggatccggcctcggtcgccgaggcggggatcttcgtctgggccatgatggccgcg
ctgatcgcggcggcggtctggctcaacatcgcgaccgccatcggcgcgccggtctcgacg
acccattcgatcgtgggcggcgtcatgggggcggggatcatggccgccggcatgtcggcg
gtgaactggccggtgatgggccagatcgccgcgagctgggtgatctctcccgttctcggc
ggcgtctttgcggcgctcttcctcgccttcatcaagaaccggctgctcgacgccgaggac
aagatcgcggccgcccgactgtgggtgccgctgctgatcggggtgatggcggccgccttt
gcgacctatctggcgctcaaggggctgcggaaggtcatggaggtgcagcttccggcggcg
gtgatgatcggcctcgcgatcggcgtggcgacggttttcctcacccggccgctggtgcgg
cgccagtccgaggggatggagaaccgcaagaaatcgctcaagaagctgttcggactgccg
ctggtggtgtcggcggccctgctgtcctttgcccatggcgccaacgacgtcgccaacgcg
gtgggcccgctggcggccatcgtccatgcggtctcgaacggcgacacggcggccagggtg
gcgatcccgctctgggtcatgatcatcggcgcgggcggcatctccttcggcctcgtgctc
ttcgggccgaagctgatccgcatggtcgggtccgagatcaccaagctgaacccgatgcgg
gcctattgcgtggcgctctcggccgcgatcaccgtgatcgtcgcgtcggggctggggctg
cccgtgtcctcgacccacatcgcggtgggcggcatcttcggcgtgggcttctaccgcgaa
tggcaggccgaacgtcgcagccgggccctcgggctgatcaagggcaagccgctgccgccc
gacgaacgcaagcgccgcaagctggtgcggcgggcgcatttcctcaccatcggcgcggcg
tgggttgtcaccgtgccggcgacggcgctgctttcgggggcggtcttcgtggcgctgcgc
accttcgcgggctga

DBGET integrated database retrieval system