KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_2529Help
Entry
Rsph17025_2529    CDS       T00512                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rsq00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Rsph17025_2529
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rsq03011]
    Rsph17025_2529
Ribosome [BR:rsq03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Rsph17025_2529
  Bacteria
    Rsph17025_2529
  Archaea
    Rsph17025_2529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 KORA
Motif
Other DBs
NCBI-ProteinID: ABP71417
UniProt: A4WVK3
Position
complement(2569940..2570320)
Genome map
AA seq 126 aa AA seqDB search
MGKDKNPRRVGENEAFAKAKMLRTSPQKLNLVAALIRGKKVEKAIADLTFSKKRISQDVL
KCLQSAIANAENNHGLDVDELVVSEAYCGKNLVMKRGRPRARGRFGKIMKPFSELTIKVK
QVGETA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggacaagaacccgcgccgcgtgggcgaaaacgaggcttttgccaaggcgaag
atgctgcgcacctcgccgcagaagctgaacctcgtcgcggccctcatccgtggcaagaag
gtcgagaaggcgatcgccgacctcaccttctcgaagaagcgcatcagccaggacgtgctg
aagtgccttcagtcggccatcgccaacgccgagaacaaccacggcctcgacgtggacgaa
ctcgtggtctcggaagcctattgcggcaagaacctcgtgatgaagcgcggccgtccgcgc
gcccggggccggttcggcaagatcatgaaaccgttcagcgagctcacgatcaaggtgaag
caagtcggggagactgcgtaa

DBGET integrated database retrieval system