KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_2788Help
Entry
Rsph17025_2788    CDS       T00512                                 

Definition
(GenBank) two component transcriptional regulator, winged helix family
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rsq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Rsph17025_2788
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:rsq02022]
    Rsph17025_2788
Two-component system [BR:rsq02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   Rsph17025_2788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ABP71675
UniProt: A4WWB1
Position
2834050..2834748
Genome map
AA seq 232 aa AA seqDB search
MSEPQAHLLVVDDDERIRSLLQKFLIRNGFLVSSARDAAQARRLLDGLEFDLIVLDVMMP
GEDGVSLTRALREDLATPILLLTARGETSHRIEGLEAGADDYLAKPFEPKELLLRINAIL
RRVPSARPELGPKVLHLGDVRYDLERGELWRGTEPVRLTATEAALMRIFAAQPGEAVSRE
RLVGDLGRDEGQSQERAVDVQITRLRRKIEVDPRQPRYLQTVRGSGYMLAPD
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagccgcaggcgcatcttctggtggtggacgatgatgagcgcattcggagcctt
ctgcagaagttcctgatcaggaacgggtttctcgtctcctccgcccgggatgcggcgcag
gcgcgccggctgctcgacgggctcgagttcgatctgatcgtgcttgacgtgatgatgccg
ggcgaggatggcgtctcgctgacgcgcgcgctgcgcgaggatctggcgacaccgatcctg
ctgctgacggcgcggggagagacgtcgcaccggatcgaggggctcgaggcgggggcggac
gactatctggccaagccgttcgagccgaaggaactgctgctcaggatcaacgcgatcctg
cggcgtgtgccgtcggcgcggccggagctggggccgaaggtgctgcatctgggggacgtg
cgctacgatctggagcggggcgagctttggcgcggcacggagccggtgcggctgacggcg
accgaggcggcgctgatgcggatctttgcggcgcagcccggcgaagcggtgagccgagag
cggctggtgggggacctcggtcgcgacgagggccagagccaggaacgcgcggtggatgtg
cagatcacccgcctccgccggaagatcgaggtcgatccgcggcagccgcgctatctccag
accgtccgcggctcgggctacatgctcgcgccggactga

DBGET integrated database retrieval system