KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_2833Help
Entry
Rsph17025_2833    CDS       T00512                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq00071  Fatty acid degradation
rsq00072  Synthesis and degradation of ketone bodies
rsq00280  Valine, leucine and isoleucine degradation
rsq00310  Lysine degradation
rsq00362  Benzoate degradation
rsq00380  Tryptophan metabolism
rsq00620  Pyruvate metabolism
rsq00630  Glyoxylate and dicarboxylate metabolism
rsq00640  Propanoate metabolism
rsq00650  Butanoate metabolism
rsq00900  Terpenoid backbone biosynthesis
rsq01100  Metabolic pathways
rsq01110  Biosynthesis of secondary metabolites
rsq01120  Microbial metabolism in diverse environments
rsq01130  Biosynthesis of antibiotics
rsq01200  Carbon metabolism
rsq01212  Fatty acid metabolism
rsq02020  Two-component system
Module
rsq_M00373  Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:rsq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rsph17025_2833
   00630 Glyoxylate and dicarboxylate metabolism
    Rsph17025_2833
   00640 Propanoate metabolism
    Rsph17025_2833
   00650 Butanoate metabolism
    Rsph17025_2833
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Rsph17025_2833
   00072 Synthesis and degradation of ketone bodies
    Rsph17025_2833
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rsph17025_2833
   00310 Lysine degradation
    Rsph17025_2833
   00380 Tryptophan metabolism
    Rsph17025_2833
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rsph17025_2833
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rsph17025_2833
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Rsph17025_2833
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rsq04147]
    Rsph17025_2833
Enzymes [BR:rsq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Rsph17025_2833
Exosome [BR:rsq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rsph17025_2833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABP71719
UniProt: A4WWF5
Position
complement(2883608..2884807)
Genome map
AA seq 399 aa AA seqDB search
MTEVFICDYIRTPIGRYGGVLSSVRADDLGAVPLKALMARNGAVDWEAVDDVIFGCANQA
GDDNRNVARMSALLAGLPVGVSGTTINRLCGSGMDAVLIAARQIAVGEAELVIAGGVESM
SRAPFVLAKAGTAFSRTAEIHDTTIGWRFVNPAMEAAHGVESMPQTGQNVAGDFGIGREA
QDAMALASQVKAAAAQASGRLAQEITPVLVAQRKGEPIPVERDEHPRATTIEALARLKPL
FPGGSVTAGNSSGVNDGAAALILATEDAARRHGLTPIARVLGGATAGVPPRIMGMGPVPA
ARKLMARLGLTEAEFDVIELNEAFAAQAVATLRHLGISDDDARVNPNGGAIALGHPLGMS
GARLIGTAALQLQLSGGRRSLSTMCVGVGQGIAVALERV
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgacagaggtcttcatctgcgactatatccgcacccccatcggccgctacggcggggtg
ctctcctccgtccgcgcggacgatctgggggcggtgccgctgaaggccctgatggcccgc
aacggcgccgtggactgggaggcggtggacgacgtgatcttcggctgcgccaatcaggcg
ggcgacgacaaccgcaacgtggcgcgcatgtcggcgctgctggctgggctgccggtcgga
gtcagcggcacgacgatcaaccggctctgcggctcgggcatggacgccgtgctgatcgcc
gcccgccagatcgcggtgggcgaggcggaactggtgatcgcgggcggcgtcgagagcatg
tcgcgcgcgcccttcgtgcttgccaaggccgggaccgccttctcgcgcacggccgagatc
cacgacaccaccatcggctggcgcttcgtcaatccggcgatggaggcggcccacggcgtc
gagtccatgccgcagaccgggcagaatgtcgccggcgatttcggcatcggccgcgaggcg
caggatgcgatggccctcgcctcgcaggtgaaggcggcggcggcgcaggcgagcgggcgg
cttgcgcaggagatcacgccggtcctcgttgcgcagcgcaagggcgagccgatcccggtc
gagcgcgacgagcatccgcgggcaacgacgatcgaggcgctggcaaggctcaagccgctc
tttccgggcggatcggtcacggcgggcaattccagcggcgtcaacgacggcgcggcggcg
ctgatcctcgcgaccgaggacgcggcccggcgccacgggctcacgcccatcgcgcgcgtg
ctggggggggccacggccggcgtcccgccgcggatcatgggcatgggccccgtgcccgcc
gcgcggaagctgatggcccggctcgggctgacggaggcggagttcgacgtgatcgaactg
aacgaggccttcgccgcacaggctgttgcgacgctccggcacctgggcatttccgatgac
gatgcgcgggtgaacccgaacgggggcgccatcgcgctcggtcatcctctgggcatgtcg
ggcgcgcgtctcatcggaaccgccgcgctccagctccagctctccggcgggcgccggtcg
ctctcgaccatgtgcgtcggcgtgggtcagggcattgcggtggccctcgagcgggtgtga

DBGET integrated database retrieval system