KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_3567Help
Entry
Rsph17025_3567    CDS       T00512                                 

Definition
(GenBank) hypothetical protein
  KO
K01578  malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq00410  beta-Alanine metabolism
rsq00640  Propanoate metabolism
rsq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rsph17025_3567
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rsph17025_3567
Enzymes [BR:rsq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Rsph17025_3567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCD MCD_N Archease
Motif
Other DBs
NCBI-ProteinID: ABP72436
UniProt: A4WYH2
Position
pRSPA01:complement(453109..454416)
Genome map
AA seq 435 aa AA seqDB search
MSRIAFFADLMGTLFERHALGAPAPSRTPVEELCAALLSAPGEVSGVRLARDILSHYRAM
GADERADFFRHLATELDLDADRVIAAATRYRDGGGPSALADLCREAEPRRQELLRRMNQA
PGATEELVRMRLDLLRLLPEAPELAAIDADFQHLFSSWFNRGFLVLRHIDWRTPANILEK
IIEYEAVHAINDWDDLQRRLRPSDRRCFAFFHPAMPEEPLIFVEVALCKGTPGSVQALLA
EGRTPLAAADCDTAVFYSISNCQEGLRGISFGNSLIKQVVEELRRDLPALRRFVTLSPVP
GLSRWLVGIAPDRPEAARLLAAGAAADPETMAPEVQTLRRLTAEYLLQARRPDGLPVDPV
ARFHLGNGALLHEIHALADVSANGFRQSCSAMVNYLYDLSQVETNTEGFLTGKVVAASKK
VQSLLAQGSTTGRKS
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcatcgccttcttcgccgatctcatgggcacgctgttcgagcgtcatgccctc
ggcgcgccggcgcccagccggacgccggtcgaggaactctgcgcggcgctgctttcggcg
ccgggcgaggtgtcgggcgtccggctggcgcgcgatatcctctcgcactaccgcgccatg
ggggccgacgagcgggcggacttcttccgccatctcgccaccgagcttgatctggatgct
gaccgggtgatcgccgccgccacgcgctaccgtgacggcggcgggccgtcggcgctggcc
gacctctgccgcgaggccgaaccccgccggcaggagctgctgcgccggatgaaccaggcg
cccggcgccacggaagagctggtgcggatgcggctcgacctgctgcgcctcttgcccgag
gcgcccgagctggccgcgatcgacgccgacttccagcatctcttttccagctggttcaac
cgcggcttcctcgtgctgcgccacatcgactggcgcaccccggccaacatcctcgagaag
atcatcgaatacgaggccgtccacgccatcaacgactgggacgacctgcaaaggcggctc
aggccctcggaccggcgctgctttgccttcttccaccccgccatgcccgaagagccgctg
atctttgtcgaggtggccctctgcaagggcacgcccggctcggtgcaggcgctgctggcc
gaaggtcgcacgccgctggccgccgccgactgcgacacggcggtgttctattccatctcg
aactgccaggaggggctgcgcggcatctccttcggcaactcgctgatcaagcaggtggtc
gaggaactgcgccgcgaccttccggcgctgcgccgcttcgtgaccctctcgccggtgccg
ggcctgtcgcgctggctcgtcgggatcgcgcccgaccggcccgaggccgcgcggctgctg
gccgccggtgccgcggccgatcccgagaccatggcccccgaggtccagaccctgcgtcgc
ctcactgccgaatatctgctgcaggcccggcggccggacgggctgccggtcgatccggtc
gcgcgcttccatctcggcaacggcgcgctcctgcacgagatccacgcgctggccgatgtc
tcggccaatggcttccgccagtcctgcagcgcgatggtcaactatctctacgacctctcg
caggtcgagaccaacaccgagggcttcctgaccggcaaggtcgtcgccgcctcgaagaag
gttcaatccctgcttgcacagggctccacgacaggaagaaagtcatga

DBGET integrated database retrieval system