KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_4015Help
Entry
Rsph17025_4015    CDS       T00512                                 

Definition
(GenBank) D-fructose 1,6-bisphosphatase
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq00010  Glycolysis / Gluconeogenesis
rsq00030  Pentose phosphate pathway
rsq00051  Fructose and mannose metabolism
rsq00680  Methane metabolism
rsq00710  Carbon fixation in photosynthetic organisms
rsq01100  Metabolic pathways
rsq01110  Biosynthesis of secondary metabolites
rsq01120  Microbial metabolism in diverse environments
rsq01130  Biosynthesis of antibiotics
rsq01200  Carbon metabolism
Module
rsq_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
rsq_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rsq_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
rsq_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rsq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rsph17025_4015
   00030 Pentose phosphate pathway
    Rsph17025_4015
   00051 Fructose and mannose metabolism
    Rsph17025_4015
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Rsph17025_4015
   00680 Methane metabolism
    Rsph17025_4015
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rsq04147]
    Rsph17025_4015
Enzymes [BR:rsq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Rsph17025_4015
Exosome [BR:rsq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rsph17025_4015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-ProteinID: ABP72868
UniProt: A4WZQ4
Position
pRSPA02:44477..45472
Genome map
AA seq 331 aa AA seqDB search
MTIELEDLGLTPELADVMQRLARVGGQIARLISRNGLETDLAAGVGTNAGGDGQKALDVI
ADNAFRAALAGSAVAHYASEEQDEVVTLGEGALALAIDPLDGSSNIDVNVSIGTIFSIFP
AAESPEASFLRLGTEQIAAGYIIYGPQCALVCSFGRGVHHWVLDLDAGIFRRMADIRPLP
AETSEFAINASNYRHWPKPVRAFIDDLMAGADGPRGKNFNMRWIASLVAETHRILMRGGV
FLYPGDDRKGYERGRLRHVYECAPIAFLITQAGGGASDGCDPILTALPDRLHARTPFVFG
CAGKVACVAAYHDLPGQETSALFGTRGLFRS
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgagcttgaggatctggggctgacccccgaactcgcggacgtgatgcagcgg
ctggcacgggtgggggggcagatcgcgcgcctcatctcgcgcaacgggctcgagaccgac
ctggcggcgggcgtgggcaccaacgccggaggcgatggccagaaggcgctcgacgtcatc
gcggacaacgccttccgcgcggcgctcgcggggtcggcggtggcccattatgcctcggaa
gagcaggacgaggtggtgacgctgggcgagggcgcgctcgcgcttgccatcgacccgctc
gacggctcgtccaacatcgacgtgaatgtctcgatcggcacgatcttctcgatcttcccc
gccgccgaaagcccggaggcgagcttcctgcgcctcggcaccgagcagatcgcggccggc
tacatcatctacgggccgcaatgcgcgctggtgtgcagcttcgggcggggggtgcatcac
tgggtgctcgacctcgatgcggggatcttccggcgcatggccgacatccggccgctgccg
gcggaaacctcggaattcgcgatcaacgcctcgaactaccgccactggccgaagccggtc
cgcgccttcatcgacgatctgatggccggcgccgacggaccgcggggcaagaacttcaac
atgcgctggatcgcctcgctggtggccgagacgcaccgcatcctgatgcggggcggggtg
ttcctctatccgggcgacgaccgcaagggatacgagcgcggccgcctgcgccatgtctat
gaatgcgcccccatcgccttcctcatcacccaggcgggcggcggggccagcgacggctgc
gacccgatcctgacggccctgcccgaccggctccatgcccgcacccccttcgtcttcggc
tgcgcgggcaaggtcgcctgcgtcgccgcctatcacgatctgccgggccaggagacatcg
gcgctcttcggcacgcgcggcctgttccggagttaa

DBGET integrated database retrieval system