KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_4255Help
Entry
Rsph17025_4255    CDS       T00512                                 

Definition
(GenBank) hypothetical protein
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:rsq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    Rsph17025_4255
Enzymes [BR:rsq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     Rsph17025_4255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ABP73104
UniProt: A4X0E0
Position
pRSPA03:14699..15466
Genome map
AA seq 255 aa AA seqDB search
MFDPGLFRLDGQIALVTGAGAGIGRGIAEMFAGAGASVVVSDLRQDTAGSVATAISDAGG
QAVGIACNVTREVDLEAAVQAAVDRFGGLTILVNNAGGGGPKPFDMPMEEFRWAYELNVF
APFRLTQLAVPHMEAAGGGAVLNISSMSGENRNQRMASYGSSKAAISHLTRNIAFDLGPK
NIRVNAIAPGAIRTDALATVLTPEVEAAMLKHTPLKRLGVPADIAAAALYLCSPAAAWVS
GQILTVSGGGVQELD
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacccaggtcttttcaggctggatgggcagattgcgctggtgacgggcgccgga
gccggcatcggccgcggcatcgccgagatgttcgccggcgcgggcgcctcggtcgtggtc
agcgatctcaggcaggacacggccggatcggtcgccacggcgatcagcgacgccggcggc
caggcggtcgggatcgcctgcaacgtcacgcgcgaagtggatctggaggccgcggtccag
gcggcggtcgatcggttcggcgggctcacgatcctggtcaacaacgccgggggtggcggg
ccgaaacccttcgacatgccgatggaggagttccgctgggcctacgagctcaacgtcttc
gccccgttccggctgacacagctggccgtgccgcacatggaggccgcgggcggcggtgcg
gtgctgaacatctcgtccatgtcgggagagaacaggaatcagcgcatggcctcctacggg
tcatcgaaggcggcgatcagccacctgacccgcaacatcgccttcgatctcgggccgaag
aacatccgcgtcaacgccatcgcgccgggcgcgatccgcaccgacgcgctggccaccgtg
ctcacgcccgaggtcgaggcggcgatgctgaagcacacgcccctcaagcggctgggcgtg
cccgccgacatcgccgcggccgctctctacctctgctcgcccgcggcggcctgggtgagc
gggcagatcctgaccgtctcgggcggcggcgtgcaggaactcgactga

DBGET integrated database retrieval system