KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109434472Help
Entry
109434472         CDS       T04863                                 

Gene name
PIK3C2B
Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta isoform X1
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00562  Inositol phosphate metabolism
rss01100  Metabolic pathways
rss04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:rss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109434472 (PIK3C2B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    109434472 (PIK3C2B)
Enzymes [BR:rss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     109434472 (PIK3C2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PI3K_rbd C2 PX DUF4135 HEAT_2
Motif
Other DBs
NCBI-GeneID: 109434472
NCBI-ProteinID: XP_019567002
Position
Unknown
AA seq 1633 aa AA seqDB search
MSSTQGSGEHWKSLESVGISRKELAMAEALQMEYDALSRLRHDKEESRTKQNTDPSLISW
DEPVLDSYSKPAGRQKDLKLLRGLSGSDPTLNYNSLSPQEGLLDHSTSQCSQPGPDPWPK
GSLARDYLYIFDGSDGGLSLSPGPGDIDDSSKKLSPPPLPPRVSIWDTPPLPPRKGSSSS
SKLSQPNDINTFSLVEQPPGKLLGCQILEEEELGSGGTGRVLGSVDYDGINDAITRLNLK
STYDAEILRDATRGWKEGRGPLGLGKDAPGKPVARSKTMPPQVPPRTYTSRYANRKNGTP
GKNHRISAASVGSRPHTVANGHELFEVSEERDEEVAAFCHMLDTLRSGSDIQDYFLTGYV
WSAVTPSPEHLGDEVNLKVTVLCDSLREPLTFTCNCSSTVDLLIYQTLCYTHDELRDVDV
GDFVLKPCGLEEFLQNKHALGSHEYIQYCCKFDIDIRLQLMEQKAVHSNLARTVNDDQSP
STLNYLVHLQERPVKQTISRQALSLLFDTYHNEVDAFLLADGDFPLKADRVVQSVKAICN
ALAAVETPEITNALNQLPPCPSRVQPKIQKDPAVLAVRENREKVVEALTAAILELVELYC
STFNADFQTAVHGSHKHDLVQDACHFAAPLAFTVYATHRIPITWAASYEDFYLSCSLSHG
GKELCSPLQTRRAHLSKYLFHLIIWDQRICFPVHVNRLPRETLLCATLYALPVPPPGSSS
EANKQRRVPEALGWVTTPLFNFRQVLTCGRKLLGLWPATQENSSARWSVPNFHQPDSVIL
QIDFPTSAFDIKFTSPSGDKFSPCYEFGSLREEDQHVLKSIMQKESLYWLTDADKKRLWE
KRYYCHSEVSSLPLVLASAPSWEWACLPDIYALLKQWTHMNHQDALGLLHATFPDQEVRH
MAVQWIGSLSDAELLDYLPQLVQALKYECYLDSPLVRFLLKRAVSDLRVTHYFFWLLKDG
LKDSQFSIRYQYLLAALLCCCGKGLREEFNRQCWLVNTLAKLAQQVREAAPSARQGILRT
GLEEVKQFFALNGSCRLPLSPSLLVKGIVPRDCSYFNSNAVPLKLSFQNVDPLGENIRVI
FKCGDDLRQDMLTLQMIRIMSKIWVQEGLDMRMVIFRCFSTGRGRGMVEMIPNAETLRKI
QVEHGVTGSFKDRPLADWLQKHNPGEDEYEKAVENFIYSCAGCCVATYVLGICDRHNDNI
MLKTTGHMFHIDFGRFLGHAQMFGNIKRDRAPFVFTSDMAYVINGGDKPSSRFHDFVDLC
CQAYNLIRKHTHLFLNLLGLMLSCGIPELSDLEDLKYVYDALRPQDTEANATTYFTRLIE
SSLGSVATKLNFFIHNLAQMKFTGSDDRLTLSFAPRTYTLQRSGRLSDVFVCRQEKVFHP
NKAYIYVVKVMRENAHEATYIQRTFEEFQELHNKLRLLFPSSLLPSFPSRFMIGRPRGDA
GAERRREELNSYIWRLIHAIPEVAECDLVYTFFHPLPRDEKAAGTSLASKSSDGTWARPV
GKVGGEVKLSISYKNNKLFIMVMHIRGLQLLQDGNDPDPYVKIYLLPDPQKTTKKKTKVA
RKTCNPTYNEMLVYDGIPKGDLQQRELQLSVLSEQGFWENVLLGEVHIRLRELDLAQEKT
GWFALGSRSHETS
NT seq 4902 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgactcagggcagcggggaacactggaagtccctggagtccgtgggcatcagc
cgcaaggagctggccatggccgaagccttgcagatggagtatgatgctctctcccggctt
cggcacgacaaggaggaaagcagaaccaagcagaacacagacccctcgctcatcagctgg
gacgagcccgtcctggattcatacagcaagccggcaggaaggcagaaggacctcaagctc
ctccgcggtctttctggctctgatcctaccctcaattacaactcgctctccccacaggaa
gggctgctcgaccactctacctcccagtgttcccagcctggcccagatccctggcccaaa
ggctccctggctagagactatctctatatttttgatggttcagatgggggcctctctttg
tccccaggaccaggggacatagatgactcttctaagaaactgtccccacctcctctgcct
ccccgagtctctatctgggacacccctcctctgcctcccagaaagggatcctcttcatcc
tctaagctctcccagcccaatgacattaacactttttcattagtcgaacagcctccaggc
aaattgctagggtgtcagatcctagaagaagaggagctgggaagtgggggcacgggacgc
gtactggggtctgtggactatgatggtatcaatgatgcaattacacggctcaacttgaag
tcaacctatgatgcagagatattgcgggatgccaccaggggctggaaggagggccggggg
cccctgggtcttgggaaggatgctcctggaaagcctgtggccaggagcaagaccatgcct
ccccaggtgccaccccgcacctacacctcccgctatgccaaccgaaaaaatgggacacct
ggcaagaaccaccggatttctgctgcttcggtgggctcccggccccacactgtcgccaac
ggccacgagttgttcgaggtctcagaggagagagatgaggaagttgctgcattttgccac
atgctggatacacttcgatctggctctgatatccaagactacttcctcactggatatgtc
tggagtgctgtcaccccaagcccagagcaccttggggatgaggtcaacctgaaggtgacg
gtgttgtgtgacagtctgcgggagccactcacttttacctgcaactgttcctccactgtg
gacttgctcatctaccagacgctgtgctacacccacgacgagctgagggatgtggatgtg
ggtgattttgtgctgaagccctgtgggctggaggagttcctgcagaacaagcacgccttg
ggcagccatgagtacattcagtactgctgcaagtttgacattgacattcgactacagcta
atggagcagaaagccgtacacagcaacctggccaggacggtaaatgatgaccagagcccc
tccactttgaactacctcgtccatctgcaggagcggcccgtcaagcagaccatcagcagg
caggccctgagtcttctgttcgacacttaccacaatgaggtggatgccttcctgctggct
gatggcgacttcccactgaaggctgacagggtggtccagtccgtgaaggccatctgcaat
gccctggctgccgtggagacccctgagatcaccaatgctctcaaccagctgcccccctgc
ccctcccgcgtgcagcctaaaattcagaaggaccccgccgtcttggctgtgagggaaaac
cgagagaaggttgtggaagccttgacagctgccatcttggaactggtggagctgtactgc
agcacgttcaatgcagacttccagacagcagtgcatgggagccacaagcatgacctggtc
caggacgcttgccattttgctgcgcccctggccttcactgtctatgccacccaccgcatc
cccatcacctgggctgccagctatgaagacttctacctctcctgctccctcagtcacggt
ggcaaggagctgtgcagccccctgcagacccgaagggctcacctttccaagtaccttttc
cacctcatcatctgggaccagcggatctgcttcccagtgcacgtgaaccggctgcctcgg
gagacgctgctgtgtgccactctctatgctctgcccgtccccccgcccgggagctcctca
gaggccaataagcagcgtcgggtgcctgaagccctgggctgggtcactacccctctcttc
aacttcaggcaagtcctaacctgtggccggaagcttctgggcttatggccagcaacacag
gaaaattccagtgcccgttggagtgtacctaatttccaccagccggacagtgtcatcctg
cagattgacttccccacctctgccttcgacatcaagttcaccagtccctctggagacaag
ttcagcccctgctatgagtttggcagcctccgagaggaagaccaacacgtgcttaaaagc
atcatgcagaaggagtccctgtactggctcactgatgctgacaagaagcgcttgtgggag
aagcgatattattgccactcagaggtgagctcgctccccttggtgctcgccagcgccccc
agctgggagtgggcttgcctgcccgacatctatgctctcctgaagcagtggacccacatg
aaccaccaggatgccctgggacttctgcatgccaccttcccggaccaggaggtccggcac
atggctgtgcagtggatcggctcgctgtcagatgctgagttgcttgactacctaccccag
ctcgtgcaggccctaaagtacgagtgctacctggacagccccttggtgcgcttcctccta
aaacgagcggtctctgacttgagagtgactcactacttcttctggttgctgaaggatggc
ctcaaggactcccagttcagcattcgctaccagtacctgctggcggccctgctgtgttgt
tgtggcaaggggctgagagaggagtttaaccgccagtgctggctggtcaacaccctggcc
aagctggcacagcaggtccgggaggctgctccgtctgcacggcaggggatcctccgcaca
ggcctggaggaggtgaaacagttctttgccctcaatggctcctgccgcctgccgctcagc
cccagtctgctggttaagggcattgtgcccagggactgttcttacttcaactccaatgca
gtccccctcaagctctccttccagaatgtggacccgctgggtgagaacatccgagtcatc
ttcaagtgcggggacgaccttcgccaggacatgctcacgctgcagatgattcgcatcatg
agtaagatctgggtccaggaggggctggacatgcgcatggtgattttccgctgcttctcc
acgggcaggggcagagggatggtggagatgatcccgaacgccgagaccctgcgcaagatc
caggtggaacatggggtgaccggctccttcaaggaccggcccctggccgactggctgcag
aagcacaaccctggggaggatgagtacgagaaggccgtggagaacttcatctattcctgt
gctggctgctgtgtggccacttacgtcttaggcatctgtgaccgacacaatgacaacatc
atgctgaagacgactggccacatgttccacatagattttggccgcttcctgggccacgcc
cagatgtttggcaatatcaagcgggaccgtgccccctttgtcttcacctcggacatggcg
tatgtcatcaacgggggtgacaagccttccagccgcttccatgattttgttgacctttgc
tgccaagcctacaacctcattcgcaagcacacccacctcttcctcaaccttctgggcctg
atgttgtcctgtgggatccctgagctctcagacctggaggacctcaagtatgtgtatgac
gccctgaggcctcaggacacagaggccaatgccaccacctactttactaggttgattgag
tccagcctgggcagtgtagccacaaagctcaattttttcatccataacctggctcagatg
aagttcacgggctcagatgaccggttgaccctttcctttgctccccgcacgtacactctc
cagcgctctggccgccttagtgatgtctttgtctgccgccaggagaaggtcttccatccc
aacaaggcctacatttatgtggtaaaggtgatgcgagagaatgctcacgaggccacttac
atccagcggacgtttgaggaattccaggagttacacaacaagctgcgactgctcttccct
tcttccctcctgcccagcttccccagtcgcttcatgattggccgccctagaggagacgca
ggggctgagcggcggagagaggagttaaacagctacatctggcgcttgatccatgccatc
ccagaggtggccgagtgtgatttggtgtataccttcttccatcctctgccccgggatgag
aaagctgcgggcaccagcctggcctccaagtcttcagacggcacatgggcccggcctgtt
gggaaggtgggaggggaggtgaagctgtccatctcctacaaaaacaataaactcttcatc
atggtgatgcatattcggggcttgcaactgcttcaggatgggaatgaccccgacccctat
gtgaaaatttacctccttcctgaccctcagaaaaccactaaaaagaaaaccaaagtggcc
cggaaaacctgcaacccaacctacaatgagatgctggtgtatgatgggatccccaagggt
gacctgcagcagcgggagctacagcttagtgtgctgagtgagcaaggattctgggagaac
gtcctcctcggggaggtgcacatccgcctgcgagagctcgacctggcccaggagaagacc
ggctggttcgcactgggatctcgaagtcatgagacctcatga

DBGET integrated database retrieval system