KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109436101Help
Entry
109436101         CDS       T04863                                 

Definition
(RefSeq) chymase-like
  KO
K01329  chymase [EC:3.4.21.39]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:rss00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    109436101
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rss01002]
    109436101
Enzymes [BR:rss01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.39  chymase
     109436101
Peptidases [BR:rss01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   109436101
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 109436101
NCBI-ProteinID: XP_019569960
Position
Unknown
AA seq 246 aa AA seqDB search
MHRLPLPLLFFLLCSRAEAGKIIGGTECKPHSRPYMAHLEIVTSQNKLLSCGGFLIRRNF
VLTAAHCTGRSIMVTLGAHNITKKEDTWQKLEVVKQFPHPKFDYIFAHHDIMLLKLKEKA
NLTLAVGTLPLPPHFSFVPPGRMCRVAGWGITEVEKLGSKTLQEVKLRLMDPQACKYFST
FDHKLQLCVGNPKKTKSVFKGDSGGPLVCAGVAQGIVSYGKNEEPPSVFTRISHYRPWIN
EVLKEN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgtcttcctctccccctgctgttctttcttctatgctccagagctgaagccggg
aagatcattgggggcaccgagtgcaagcctcactcccgcccctacatggcccacctggaa
attgtcacttcccagaataagctgcttagttgtggtggtttcctgataagacggaacttt
gtgctgacggctgctcactgcacaggaaggtctataatggtcacccttggagcccataac
ataacaaagaaagaagacacatggcagaagcttgaggtcgtaaaacaattccctcatcca
aaatttgattacatttttgctcatcatgacatcatgttactaaagttgaaggagaaagcc
aacctgaccctggctgtggggacactcccccttccacctcacttcagcttcgtcccacca
gggagaatgtgccgggtggccggctggggaataacggaagtggagaaattgggctccaag
actctgcaagaggtgaagctgagactcatggatccccaggcctgtaaatatttcagcact
tttgaccacaaactccagctgtgtgtggggaatcctaagaagacaaaatctgtatttaag
ggagactcggggggccctcttgtgtgtgctggcgtggcccagggcattgtctcctatgga
aagaatgaagaacccccttctgtcttcacccggatctcccattaccggccctggatcaac
gaggtcctaaaagagaattaa

DBGET integrated database retrieval system