KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109438205Help
Entry
109438205         CDS       T04863                                 

Gene name
FKBP2
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP2 isoform X1
  KO
K09569  FK506-binding protein 2 [EC:5.2.1.8]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Brite
KEGG Orthology (KO) [BR:rss00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rss03110]
    109438205 (FKBP2)
Enzymes [BR:rss01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     109438205 (FKBP2)
Chaperones and folding catalysts [BR:rss03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    109438205 (FKBP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 109438205
NCBI-ProteinID: XP_019573462
Position
Unknown
AA seq 156 aa AA seqDB search
MCGCLEAGPLQRLQRDMRLNWVLTVLSICLSALATAAGAEGKRKLQIGVKKRVDHCPIKS
RKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVI
PSELGYGERGAPPKIPGGATLVFEVELLKIERRSEL
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgggtgcctcgaggccggccccctgcagcggctgcagagagacatgaggctgaac
tgggtcctgacagtactgtccatctgcctgagcgccctggccacggccgcgggggccgag
ggcaaaaggaagctgcagatcggggtcaagaagagagtagatcactgtcccatcaaatcg
cgcaagggggacgtcctgcacatgcactacacggggaagctggaagatgggacggagttt
gacagcagcctgccccagaaccagccctttgtcttctccctgggcacgggccaggtcatc
aagggctgggaccaggggctgctggggatgtgtgagggggaaaagcggaagctggtgatc
ccgtcagagctggggtatggagagcggggagccccgccaaagattccaggtggtgcaacc
ctggtgttcgaggtggaactgctcaaaatcgagcgacgttcagaactgtag

DBGET integrated database retrieval system