KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109438617Help
Entry
109438617         CDS       T04863                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase isoform X1
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00561  Glycerolipid metabolism
rss01100  Metabolic pathways
rss04714  Thermogenesis
rss04723  Retrograde endocannabinoid signaling
rss04923  Regulation of lipolysis in adipocytes
Module
rss_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:rss00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    109438617 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    109438617 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    109438617 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    109438617 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rss01002]
    109438617 (MGLL)
Enzymes [BR:rss01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     109438617 (MGLL)
Peptidases [BR:rss01002]
 Serine Peptidases
  Family S33
   109438617 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Lipase_3 Esterase Abhydrolase_5 DLH Peptidase_S9 Thioesterase PGAP1 Abhydrolase_2 LIDHydrolase BAAT_C DUF1350
Motif
Other DBs
NCBI-GeneID: 109438617
NCBI-ProteinID: XP_019574160
Position
Unknown
AA seq 346 aa AA seqDB search
MPRCDRGDEGTALNCLALILKAVVVVECKSHDKMETGLGDPFKMPEESSPRRTPQSVRYQ
DLPHLVNADGQYLFCRYWKPEGTPKALVFVSHGAGEHCGRYDELAQMLVGLELLVFAHDH
VGHGQSEGERMVVSDFHVFIRDVLQHVDTMQKDYPELPVFLLGHSMGGAITILTAAEKPG
YFSGMILISPLVLANPESATTFKVLAAKVLNLVLPNMSLGPIDASVLSRNKTEVDLYNTD
PLICRAGLKVCFGIQLLNAVSRVERALSKLTVPFLLLQGSADRLCDSKGAYLLMESAKSQ
DKTLKIYEGAYHVLHKELPEVTNSVFHEINMWISQRTAAARTGSPP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgctgtgaccgcggcgatgagggaacagcccttaattgcctggctctgattctc
aaggctgtcgtggttgtggaatgcaaaagccacgacaagatggaaacaggacttggagat
cctttcaaaatgccggaggaaagttctcccaggcggacaccgcagagcgttcggtaccag
gacctccctcatttggtcaatgctgatggacagtacctcttctgtaggtactggaaaccc
gagggcactcccaaggcccttgtctttgtgtcccatggagctggagagcactgcggtcgc
tatgatgagctagctcagatgctggtggggctagaactgctggtgtttgctcacgaccat
gttggccatggacagagcgaaggggagaggatggtagtgtccgacttccatgttttcatc
agggatgtgttacaacacgtggataccatgcagaaagactacccagagcttcctgtcttc
cttctgggccactccatgggaggtgccatcaccatcctcacagccgcagagaagccaggt
tacttttccggcatgattctcatttcacctttggttctggccaatcctgagtccgcaaca
actttcaaggtccttgctgcgaaagttctcaaccttgtcctgccaaacatgtccctgggc
ccaattgatgccagcgtgctctctcggaataagacggaggtggacctttacaacacagac
cccctcatctgccgggcaggactgaaagtgtgctttggcatccagctgctcaatgccgtc
tcgcgggtggagcgggccctctccaagctgactgtgcccttcctgctgctccagggctct
gctgaccgcctgtgcgacagcaaaggggcctatttgctcatggagtctgccaagagtcag
gacaagacactcaagatttatgaaggtgcctaccacgttctccacaaagagcttcctgaa
gtaaccaactctgtcttccatgaaataaacatgtggatctctcaaaggacagcggcagcg
agaacagggtccccaccctga

DBGET integrated database retrieval system