KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109439267Help
Entry
109439267         CDS       T04863                                 

Gene name
FKBP4
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP4
  KO
K09571  FK506-binding protein 4/5 [EC:5.2.1.8]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss04915  Estrogen signaling pathway
Brite
KEGG Orthology (KO) [BR:rss00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    109439267 (FKBP4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rss03110]
    109439267 (FKBP4)
Enzymes [BR:rss01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     109439267 (FKBP4)
Chaperones and folding catalysts [BR:rss03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    109439267 (FKBP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C TPR_1 TPR_2 TPR_8 TPR_12 TPR_6 TPR_11 TPR_16 TPR_14 TPR_19 FKBP_N_2 TPR_9 TPR_7 PknG_TPR TPR_17
Motif
Other DBs
NCBI-GeneID: 109439267
NCBI-ProteinID: XP_019575088
Position
Unknown
AA seq 459 aa AA seqDB search
MTAEKMKAAESGAQSAPLPLEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVSVHYTGW
LLDGTKFDSSLDRKDKFCFDLGKGEVIKAWDIAVATMKVGEVCHITCKPEYAYGLAGSPP
KIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIRTRGEGYARPNDGAIVEVALEGYYED
QLFDRRELHFEINEGESLDLPCGLEKAIQRMEKGEHSIVYLKPSYAFGSVGKEKFHIPPN
AELKYEVHLKNFEKAKESWEMNAEEKLEQSTIVKERGTVYFKEGKYKQASLQYKKIVSWL
EYESSFSGEDAQKVQSLRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRG
EAHLAVNDFDLARADFQKVLQLYPNNKAAKAQLAVCHQRIRKQIAREKKLYANMFERLAE
EECKAKAAIATGDGHADTEMKDEQKKDVAGSQPQVETEA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctgagaagatgaaggcggccgagagcggggcgcagtcggcacccctgcccctg
gagggagtggacatcagtcccaagcaggatgaaggagtactgaaggtcatcaagcgggag
ggcacgggcacagagatgcccatgattggggaccgagtctcagttcactacactggctgg
ctgttagatggcaccaagtttgactccagtctggaccgcaaggacaaattctgctttgac
ctgggaaaaggggaggtcatcaaggcttgggacattgccgtggcaaccatgaaagtggga
gaagtgtgccacatcacctgcaaaccagaatatgcctacggtttggcgggcagccctcca
aagattcctcccaatgccacgcttgtgtttgaggtggagttgtttgagttcaagggagag
gacctgacagaagaagaagatggcggaatcatccggagaatacggactcggggtgaaggc
tatgccagacccaacgatggtgcaattgtggaggttgcactggaaggatactacgaggac
cagttatttgaccggcgagagctccactttgagattaatgagggggagagtctggatctg
ccgtgtgggctggagaaagccattcagcgcatggaaaaaggagaacactctattgtatac
ctcaagcccagctatgcttttggcagtgttgggaaggaaaagttccacatcccaccaaat
gctgagctgaagtatgaagtccacctgaagaattttgagaaggccaaggagtcttgggag
atgaatgcagaggagaagctggaacagagcaccatagtgaaagagcggggcaccgtgtac
ttcaaggaaggcaagtacaagcaagcttcactgcaatacaagaagattgtgtcctggctg
gaatacgagtcgagcttctctggtgaggatgcacagaaggtacagtcccttcggctggcc
tcccacctcaacctggccatgtgtcatctgaaactacaggccttctcagctgccattgaa
agttgtaacaaggccctggaactggacagcaacaatgagaaaggccttttccgccgggga
gaggcgcacctggcagtgaatgacttcgacttggcacgggctgatttccagaaggtcctg
cagctctaccccaacaacaaagccgccaaggcccagctggctgtctgccaccagcggatc
cgcaagcagatcgcaagggagaagaaactctatgccaacatgtttgagaggctggctgag
gaggaatgcaaggccaaggcagcaatagccacaggagacggtcatgctgacacagagatg
aaggatgagcagaagaaggatgtggcagggagccagcctcaggtggagacagaagcatag

DBGET integrated database retrieval system