KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109441049Help
Entry
109441049         CDS       T04863                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 4
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00520  Amino sugar and nucleotide sugar metabolism
rss01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    109441049
Enzymes [BR:rss01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     109441049
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 adh_short
Motif
Other DBs
NCBI-GeneID: 109441049
NCBI-ProteinID: XP_019576783
Position
Unknown
AA seq 438 aa AA seqDB search
MASELTYRGHETEQPEAQAYYRKPTKPWFVAIRPIRYMLREQRLVFVLVGIAIATLGFAL
FSRSSTHPIPYADPLPGYGMRSSEYLPAAQRRPSIEYMTAGMGSAGGKIPLGLKRKGLRV
VVTGGAGFVGSHLVDRLIARGDNVIVVDNFFTGRKENVMHHFGNPNFELIRHDVVEPILL
EVDQIYHLACPASPVHYKFNPVKTIKTNVVGTLNMLGLAKRVGARFLLTSTSEVYGDPLQ
HPQVETYWGNVNPIGVRSCYDEGKRTAETLAMDYHRGANVEVRIARIFNTYGPRMCIDDG
RVVSNFVAQALRKEPLTVYGDGKQTRSFQFVSDLVEGLMRLMEGEHVGPFNLGNPGEFTM
LELAKVVQETIDPNAKIEFRPNTEDDPHKRKPDITKAKELLGWEPKVALRQGLPLMVKDF
RQRVFGDQKQETTSSSTE
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggagctgacataccggggacacgagacggagcagccggaagcgcaagcttac
taccggaagccaaccaagccgtggttcgtggcgatccgtccgatccgttacatgctccgc
gagcagaggctcgtcttcgttctcgtcggcattgcaatcgccacattaggtttcgcactt
ttctcccgatcctccacccacccgattccctacgcggatccgctcccaggatacgggatg
agatcgtcggagtacctcccggcggcgcagaggagacctagcatcgagtacatgaccgcc
gggatgggatcggcggggggaaaaatccccctggggctcaaacgcaaagggctccgggtg
gtggtgaccggtggggccggtttcgtcgggtctcacctggtggaccggttgatcgcgaga
ggagacaacgtgatcgtcgtcgacaacttcttcacggggcgcaaggagaacgtgatgcac
cacttcgggaacccaaacttcgagctcatcaggcacgacgtcgtcgagcccatccttctc
gaggtcgaccagatctaccacttggcctgcccggcttctccggttcactacaaattcaat
ccggtcaagaccatcaagaccaacgtcgtggggacgctcaacatgttgggtctagccaag
cgagtcggtgccagattcctcctcaccagcaccagcgaggtctacggagatcctctgcaa
caccctcaggttgagacctactggggcaacgttaatcccatcggtgttcggagttgttac
gacgaagggaaacgtacggcggagactttggccatggactaccacagaggcgctaatgtt
gaggttaggattgctcggatcttcaatacttatggcccaaggatgtgtatagatgacggt
cgtgtggttagcaacttcgttgcgcaggcattgagaaaagagccattgactgtttatggt
gatggtaagcagaccaggagtttccaatttgtctctgatctggtggagggtctgatgagg
ttgatggaaggagaacatgttgggccgtttaaccttggtaaccctggtgaattcaccatg
cttgagcttgctaaggtggttcaagagacgattgacccgaacgcaaagatagagtttagg
cccaacacagaggacgacccacacaagaggaaaccagacatcacaaaggccaaagagctt
cttggttgggaaccaaaggtggctctgcgccaaggactcccactcatggtcaaagatttc
cgtcaacgtgtctttggcgaccaaaagcaggagaccacttcgtcatcaacagaataa

DBGET integrated database retrieval system