KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109441524Help
Entry
109441524         CDS       T04863                                 

Gene name
MAPK4
Definition
(RefSeq) mitogen-activated protein kinase 4
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:rss00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    109441524 (MAPK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rss01001]
    109441524 (MAPK4)
Enzymes [BR:rss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     109441524 (MAPK4)
Protein kinases [BR:rss01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   109441524 (MAPK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo
Motif
Other DBs
NCBI-GeneID: 109441524
NCBI-ProteinID: XP_019577301
Position
Unknown
AA seq 585 aa AA seqDB search
MAEKGDCIASVYGYDLGGRFVDFQPLGFGVNGLVLSAVDSRACRKVAVKKVTLSDSRSMK
HALREVKIIRRLDHDNIVKVYEVLGPQGADLQGELFKFSVAYIVQEYMETDLARLLEQGT
LTEEHAKLFMYQLLRGLKYIHSANVLHRDLKPANIFISTEDLVLKIGDFGLARIVDQHYS
HKGYLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCILAEMLTGRMLFAGAHELEQMQL
ILETIPVIREEDKDELLKVMPSFVNSTWEVKRPLRKLLPEVNSEAIDFLEKILTFNPMDR
LTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDDILLMAANQSQLSNWDRYPVSLSSD
LEWRPDRCQDPNEVQRDPRAGSAPLAEDVQVDPRKDSHSSSERFLEQSHSSMERAFEADY
GHSCDYKVGSPSYLDKLLWRDNKPHHYSEPKLILDLSHWKQAAGAAPTAAVATDAGARED
EPASLFLEIAQWVKSTQGGLERTSPPPQGPERGLSASPPRCPAPRDGDGGASPQFDLDVF
ISRALKLCTKPEDLPENKLGDLNGTCISEHPGDLVQTEAFSKERW
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaaagggcgactgcatcgccagtgtctacgggtatgacctcggtgggcgcttt
gttgactttcaacccttgggcttcggtgtcaacgggcttgtgctgtcagccgtggacagc
agagcctgccgcaaggtggctgtgaagaaggtcaccctgagtgactcccgcagcatgaag
catgcactccgggaggtcaagatcatccggcgtctggaccatgacaacatcgtgaaggtg
tacgaggtgttggggccccagggtgccgacctgcagggcgagctgttcaagttcagcgtg
gcctacatcgtccaggagtacatggagaccgacctggcccgcctgctggagcagggcacg
ctgacagaggagcacgccaagctgttcatgtaccagctgctccgcggcctcaagtacatc
cactcggccaatgtgctacacagagacctgaagccggccaacatcttcatcagcacggag
gaccttgtgctcaagatcggggacttcgggttggcgaggatcgtggaccagcattattcg
cacaagggttatctgtcagaaggcttggtaacgaagtggtaccgctcaccgcgtctgctc
ctgtcgcctaacaactacaccaaagccatcgacatgtgggctgccggctgcatcctggcc
gagatgctcacaggaagaatgctctttgcaggagctcacgagctggagcagatgcagctc
atcctggagaccatccctgtgatccgggaggaggacaaggacgagctcctcaaggtgatg
ccttccttcgtcaacagcacctgggaggtgaagaggccactgcgcaagctgctccccgag
gtgaacagtgaagccatcgactttctggagaagatcttgacctttaaccccatggatcgc
ctaacagccgagatggggctgcagcacccctacatgagcccgtactcgtgccccgaggat
gagcccacctcgcagcaccccttccgcatcgaggacgagattgatgacatcctgctgatg
gccgccaaccagagccagctctccaactgggacaggtaccctgtgagcctgtcatcagac
ctagagtggcggccagaccggtgccaggacccgaacgaggtgcagcgcgacccgcgcgcg
ggctcggcgccgctggcggaggacgtgcaggtggacccgcgcaaggactcacacagcagc
tccgagcgcttcttggagcagtcgcactcatccatggagcgcgccttcgaggcggactac
ggacactcctgcgactacaaggtggggtctccgtcctacctggacaagctgctgtggcgc
gacaataagccgcaccactactcagagcccaagctcatcctggacctgtcgcactggaag
caggctgctggcgcggcccccaccgctgccgtggcgacggacgccggagcccgggaggac
gagcccgccagcctcttcctggagatcgcgcagtgggtcaagagcacgcagggcggcctg
gagcgcaccagcccgcctccccagggtcctgaacgcggcctgtctgcctctccgccccgc
tgtccagccccccgcgacggcgacggaggcgctagcccccagttcgacctggatgtgttc
atctcccgcgccctgaagctctgcaccaagcctgaggatctgccagaaaataaactgggc
gacctcaatggcacgtgcatctccgagcaccctggggatctcgtgcagacggaggccttc
tccaaagaaaggtggtga

DBGET integrated database retrieval system