KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109441935Help
Entry
109441935         CDS       T04863                                 

Definition
(RefSeq) phosphoenolpyruvate carboxykinase [ATP]
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00010  Glycolysis / Gluconeogenesis
rss00020  Citrate cycle (TCA cycle)
rss00620  Pyruvate metabolism
rss01100  Metabolic pathways
rss01200  Carbon metabolism
Module
rss_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
rss_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
Brite
KEGG Orthology (KO) [BR:rss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109441935
   00020 Citrate cycle (TCA cycle)
    109441935
   00620 Pyruvate metabolism
    109441935
Enzymes [BR:rss01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     109441935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPCK_ATP AAA_33 AAA_24
Motif
Other DBs
NCBI-GeneID: 109441935
NCBI-ProteinID: XP_019577744
Position
Unknown
AA seq 419 aa AA seqDB search
RIKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGKFPCNRYTHYMTSSTSV
DINLGRREMVILGTQYAGEMKKGLFGVMHYLMPKRKILSLHSGCNMGKDGDVALFFGLSG
TGKTTLSTDHNRYLIGDDEHCWSETGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGTVLE
NVVFDEHTREVDYTDKSVTENTRAAYPIEYIPNSKIPCVGPHPKNVILLACDAFGVLPPI
SKLDLAQTMYHFISGYTALVAGTEEGVKEPRATFSACFGAAFIMLHPTKYAAMLAEKMQA
QGATGWLVNTGWSGGSYGSGSRIKLAYTRKIIDAIHSGSLLNATYQKTEIFGLEIPNEVE
GVPSEILEPMNAWEDKVAYKDTLLKLAGLFRNNFETFTSHKIGEDGKLTEEILAAGPNF
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
agaatcaaagtcagaattgtatcagcaagagcttaccattcacttttcatgcacaacatg
tgtatccgtccaacacctgaagagctagagaatttcgggacacccgatttcacgatctac
aacgccggaaaattcccctgtaaccgttacactcattacatgacatcatccactagtgtg
gacataaacctaggaagaagagagatggtaattctaggcacacaatatgctggagaaatg
aagaagggtctctttggtgtgatgcactatttgatgcctaagagaaagattttgtctctt
cactctggttgtaacatgggcaaagatggagatgttgctctctttttcggactctctgga
accgggaagactacattgtcgaccgaccacaaccgttatttgatcggagatgatgaacat
tgttggagtgagaccggagtctccaacatcgaaggtggctgttacgcgaaatgcattgat
ctatcgagggagaaagagcctgatatctggaacgctatcaaattcggaactgttttggag
aatgttgtgtttgatgagcacacgagagaagtggactatacagacaaatcagtgacggag
aacacacgtgcggcttatccgattgagtatatcccaaactctaagataccgtgcgttgga
ccacacccgaagaacgtgatcctactggcttgtgatgccttcggtgtgttgccgcctatc
agcaagcttgatcttgctcagactatgtatcatttcatcagtggctacactgctctcgtt
gcaggaacagaggaaggagtgaaggagccaagagcgactttctcggcttgtttcggtgct
gctttcattatgcttcacccaacaaaatacgcagctatgttagccgagaaaatgcaagct
caaggagctaccggttggcttgttaacactggctggtccggtggaagctatggatctgga
agtcggatcaagttggcgtatacacgaaagattattgacgctatacattcgggtagtctc
ttgaatgcgacttatcagaaaacagaaatttttggtttggagattccaaatgaggttgaa
ggagtgccttctgagattctggaacctatgaatgcatgggaagacaaagtggcttataag
gacacattgttgaagttggctggtttgtttagaaacaattttgagacattcacaagtcat
aagattggagaagatggaaaattaactgaagagattcttgcagctggtccaaacttctga

DBGET integrated database retrieval system