KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109442324Help
Entry
109442324         CDS       T04863                                 

Definition
(RefSeq) caffeoylshikimate esterase-like
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00561  Glycerolipid metabolism
rss01100  Metabolic pathways
rss04714  Thermogenesis
rss04723  Retrograde endocannabinoid signaling
rss04923  Regulation of lipolysis in adipocytes
Module
rss_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:rss00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    109442324
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    109442324
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    109442324
  09159 Environmental adaptation
   04714 Thermogenesis
    109442324
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rss01002]
    109442324
Enzymes [BR:rss01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     109442324
Peptidases [BR:rss01002]
 Serine Peptidases
  Family S33
   109442324
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Peptidase_S9 Abhydrolase_6 AXE1 DLH Abhydrolase_3 Esterase FSH1
Motif
Other DBs
NCBI-GeneID: 109442324
NCBI-ProteinID: XP_019578140
Position
Unknown
AA seq 345 aa AA seqDB search
MMKLKFDYEEEYIRNSRGVELFACRWVPSSSPKALIFLCHGYGMECSGFMRECGIRLASA
GYAVFGMDYEGHGRSKGARCYIKKFGNIVNDCYDYYTSISAQEEYKEKGRFLYGESMGGA
VSLLLHKKDPSFWNGAILVAPMCKISEKVKPHPVVINLLTRVEEIIPKWKIVPTKDVIDA
AFKDPVKREEIRNNKLIYQDKPRLKTALEMLRTSMNLEDTLHEITLPFFVLHGEADTVTD
PEISKALFEKASTRDKTIKLYPGMWHGLTSGEPDANVDLVFADIINWLHVRTGDSASLTV
TPITANVETVVEGACDDQVKPKRQQASLLCGLNGGGRRLVHRSSM
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagttaaagttcgattacgaggaggaatacataagaaactcgagaggcgtcgag
ttgttcgcttgcagatgggttccatcttcttctcccaaagctctgatcttcctctgccat
ggctacggaatggagtgcagtggcttcatgagagaatgcgggatacggctggcttcagca
ggatatgccgtatttggaatggactacgaaggtcatggtcggtccaaaggagctcgttgt
tacatcaagaagttcggtaacatagtaaacgattgctacgactattacacctccatctct
gcgcaagaagaatataaagaaaaaggcagattcttgtatggcgaatccatgggaggtgcg
gtttctttgttgcttcacaagaaagatccttctttctggaacggtgccattctcgtcgct
ccaatgtgtaagatatcagagaaggtgaaaccacatccagtagtgattaatctactaacg
agagtggaagagattataccaaaatggaagatcgtgcccacaaaagatgttatcgatgca
gccttcaaagatccggtcaagcgcgaagagataagaaacaacaagctgatatatcaagac
aaaccaagactcaaaaccgcacttgagatgcttagaacgagtatgaacctggaagatact
ctccacgagatcacattacccttctttgttctccacggtgaggcagacacagtgaccgat
ccagagattagcaaagctctgttcgagaaagcaagcacacgtgacaaaactattaaactt
tatccaggcatgtggcatgggttgacttctggtgagcctgacgccaacgttgacctcgtt
tttgccgacatcattaattggcttcatgttcgtaccggcgactccgcttctctcactgtc
actccgatcaccgcaaatgttgaaacggtcgttgaaggcgcttgtgacgatcaagtgaag
cctaaacggcaacaggctagtcttctctgtgggttaaacggtggtggacgccgtctggtc
catcgatcttctatgtaa

DBGET integrated database retrieval system