KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109442690Help
Entry
109442690         CDS       T04863                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00052  Galactose metabolism
rss00500  Starch and sucrose metabolism
rss01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109442690
   00500 Starch and sucrose metabolism
    109442690
Enzymes [BR:rss01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     109442690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32C Glyco_hydro_32N
Motif
Other DBs
NCBI-GeneID: 109442690
NCBI-ProteinID: XP_019578516
Position
Unknown
AA seq 303 aa AA seqDB search
LDDTKHDYYTIGSYDRVGDKFVPDKGLKMDGTAPRYDYGKYYASKTFYDSAKNRRVLWGW
TNESSSVEDDVEKGWSGIQTIPRKIWLHRSGKQLIQWPVREVERLRTKQVNLRNKVLNSR
SRLEVYGVTAAQADVEVLFKVRDLEKADVIEPSWNDPQMICSQMNVSVKSSFGPFGLMAL
ASKNLEEYTSVYFRIFKARQNSNKYVVVMCSDQSRSSLNEDNDKTTYGAFVDINPRQPLS
LRALIDHSVVESFGGRGRACITSRAYPKLAIGKNSHLFAFNYGSQSVDVLSLSAWSMKYA
QIS
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
ttggatgacacgaaacatgattattacactattggttcgtacgatcgggttggagataag
ttcgtacccgataagggtttaaagatggacggtacggctccgagatacgattatgggaag
tattacgcgtcgaaaacgttttacgactcggccaagaaccggagagtattgtggggttgg
actaacgagtcatcatcggttgaggatgatgttgagaaaggctggtccggtattcagacg
attccaaggaaaatttggcttcatcggtccgggaaacaattgattcaatggccggttagg
gaagtagagagattacgtacgaagcaagtcaacttacgtaacaaagttctgaattcaaga
tctagactagaagtctatggtgtgacagctgcacaggcggatgtggaggttttgttcaaa
gtgagagatttggagaaagcggatgtgatagaaccaagttggaatgatccacagatgatt
tgtagtcagatgaatgtgtcggttaagtccagtttcggtccatttggtttaatggctctt
gcatctaaaaacttggaagagtacacatcggtttattttagaatcttcaaagcccgtcaa
aatagcaataagtacgttgtggtcatgtgcagtgaccaaagcagatcgtcactgaatgaa
gataatgacaaaacgacttatggagcttttgtggatattaatcctcgccaaccactctcc
cttcgagccttgatcgatcattccgtagtggagagttttggtggacgaggaagagcatgc
attacctccagagcgtatccaaaattggcaataggaaaaaattcacatctgtttgctttt
aattatggctctcaaagtgttgatgtcttaagcctaagcgcttggagcatgaagtatgcc
caaatcagttga

DBGET integrated database retrieval system