KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109443595Help
Entry
109443595         CDS       T04863                                 

Gene name
ABHD6
Definition
(RefSeq) monoacylglycerol lipase ABHD6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:rss00001]
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    109443595 (ABHD6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rss01002]
    109443595 (ABHD6)
Enzymes [BR:rss01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     109443595 (ABHD6)
Peptidases [BR:rss01002]
 Serine Peptidases
  Family S33
   109443595 (ABHD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr FSH1 DUF1057 DLH Thioesterase BAAT_C C9orf72-like
Motif
Other DBs
NCBI-GeneID: 109443595
NCBI-ProteinID: XP_019579709
Position
Unknown
AA seq 336 aa AA seqDB search
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIKIYYWYWRRALGMQVRYVRHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLTLVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
IDGQVKRIHQFVECLKLNKKPFHLVGTSMGGNVAGVYAAYYPSDICSLSLVCPAGLQYSS
DNQFIQRLKELQNSAAIEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
SFYRKLFLEIASEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKAIANCQVEL
LENCGHSVVMERPRKTAKLIVDFLASVHNTDNKKLD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggacctggacgtggttaacatgtttgtgattgcaggcgggacgctggccatccccatc
ctggcgtttgtagcctcgtttctcctgtggccttcagcgctgataaaaatctattattgg
tactggcggagggctttgggtatgcaggtccgctacgttcgccatgaagactatcagttc
tgctattccttccgtggcaggcctgggcacaaaccttccatcctcatgctccacggcttc
tctgcgcacaaggatatgtggctcaccttggtcaagttccttccaaagaacctgcacttg
gtctgtgtggacatgccaggacatgagggcaccacccgctcttccctggatgacctgtcc
atcgacgggcaagtcaagaggatacaccagtttgtagaatgcctcaagctgaacaaaaaa
ccattccacttggtaggtacctccatgggcggcaacgtggctggggtgtacgctgcttac
tacccatcagatatctgcagcctatctctcgtgtgccctgctggcctgcaatactcaagt
gataatcaattcatacaacggctcaaagaactgcagaactcagccgccatagagaagatt
cccttgatcccatccaccccagaagagatgagtgaaatgcttcagctttgctcctacgtc
cgcttcaaggtgccccagcagatcctgcaaggacttgtcgacgtccgcatccctcataac
agcttctaccgaaagctgtttttggaaatcgccagtgagaagtcgcggtattcccttcat
cagaacatggacaagatcaaggtcccaacgcagatcatctgggggaaacaagaccaggtg
ctcgatgtgtctggggcagacatgttggccaaggccatcgccaactgccaagtggaactt
ctggaaaactgtgggcactcggtggtgatggagagacccaggaagacagccaagctcatc
gtcgactttttagcttctgtgcacaacacagacaacaagaagctggactga

DBGET integrated database retrieval system