KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109445141Help
Entry
109445141         CDS       T04863                                 

Gene name
ACVR1C
Definition
(RefSeq) activin receptor type-1C isoform X1
  KO
K13568  activin receptor type-1C [EC:2.7.11.30]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss04060  Cytokine-cytokine receptor interaction
rss04350  TGF-beta signaling pathway
rss04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    109445141 (ACVR1C)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109445141 (ACVR1C)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109445141 (ACVR1C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rss01001]
    109445141 (ACVR1C)
Enzymes [BR:rss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     109445141 (ACVR1C)
Protein kinases [BR:rss01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   109445141 (ACVR1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 109445141
NCBI-ProteinID: XP_019582742
Position
Unknown
AA seq 489 aa AA seqDB search
MTRALCQVLLLLAAAAALSAGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVTKSCV
SLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNTPKLGPMELIVVITVPVCL
LSIAAVLTVWACHGRQCTHRKKKRQNVEEPLSECNLVNAGKTLKDLIYDVTASGSGSGLP
LLVQRTIARTIVLQEIVGKGRFGEVWHGRWCGEDVAVKIFSSRDERSWFREAEIYQTVML
RHENILGFIAADNKDNGTWTQLWLVSEYHEQGSLYDYLNRNIVTVAGMIKLALSIASGLA
HLHMEIVGTQGKPAIAHRDIKSKNILVKKCETCAIADLGLAVKHDSILNTIDIPQNPKVG
TKRYMAPEMLDDTMNVNIFESFKRADIYSVGLVYWEIARRCSVGGIVEEYQLPYYDMVPS
DPSIEEMRKVVCDQKFRPSIPNQWQSCEALRVMGRIMRECWYANGAARLTALRIKKTISQ
LCVKEDCKA
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgacccgagcactctgccaggttctcctgctgctcgccgcagccgcggctctctcagca
ggattgaagtgtgtatgtcttttgtgcgactcttcaaacttcacctgccaaacagaagga
gcatgttgggcttcagttatgctaaccaatggaaaagagcaggtgaccaagtcctgtgtc
tctctcccagaattaaatgctcaagtcttctgtcatagttccaacaatgtcaccaaaacc
gaatgctgcttcacagatttctgcaacaacataacactgcaccttccaacagcttcacca
aatacccccaaactcggacccatggagctgatcgttgttattaccgtgccagtgtgcctc
ctgtccatagctgcagtgctgacagtatgggcgtgccatggtcggcagtgcacacacagg
aagaaaaagagacagaatgtggaggagcctctgtctgaatgcaacctagtaaatgctgga
aaaactctaaaagatctgatttacgatgtgaccgcctctggatctggatctggtctacct
ctattggttcaaagaacaattgccaggacgattgtacttcaggagatagtaggaaaaggt
agatttggtgaggtctggcatggaagatggtgtggggaagatgtggctgtgaaaatattc
tcctccagagatgaaagatcttggtttcgtgaggcagaaatttatcagacggttatgctg
agacatgaaaacatccttggtttcattgctgctgacaacaaagataatggaacttggact
caactctggcttgtctcggaatatcatgagcagggctccttatatgactatttgaataga
aacatagtgacagtggctggaatgatcaaattggcactttcaatagctagtggtctggct
caccttcatatggagattgtgggtacacaaggtaaacctgctattgctcatcgagatata
aaatcaaagaatatcttagtgaaaaaatgtgaaacttgtgccatagctgacttaggatta
gctgtgaaacacgattcaatactgaacactattgacatacctcagaatcctaaagtggga
accaaaaggtacatggcccctgaaatgcttgatgatacaatgaatgtgaatatttttgag
tccttcaaacgcgctgatatctattctgttggtctggtgtactgggaaatagcccgaagg
tgttcagttggaggaattgttgaggagtaccagttgccttattatgacatggtgccttca
gatccctcaatagaggaaatgagaaaagttgtttgtgaccagaagtttcgaccaagtatc
ccaaaccagtggcaaagctgtgaagcactccgggtcatggggagaataatgcgggagtgt
tggtatgcaaatggggctgcccgcctaaccgcccttcgtattaagaagactatttctcaa
ctgtgtgttaaagaagactgcaaagcctga

DBGET integrated database retrieval system