KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109450404Help
Entry
109450404         CDS       T04863                                 

Gene name
PC
Definition
(RefSeq) pyruvate carboxylase, mitochondrial isoform X1
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00020  Citrate cycle (TCA cycle)
rss00620  Pyruvate metabolism
rss01100  Metabolic pathways
rss01200  Carbon metabolism
rss01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109450404 (PC)
   00620 Pyruvate metabolism
    109450404 (PC)
Enzymes [BR:rss01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     109450404 (PC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C Biotin_lipoyl_2 ATP-grasp_3 GCV_H RnfC_N
Motif
Other DBs
NCBI-GeneID: 109450404
NCBI-ProteinID: XP_019593223
Position
Unknown
AA seq 1178 aa AA seqDB search
MLKFRTVRGGLTLLGIRRTSTAPAASPHVRRLEYKPIKKVMVANRGEIAIRVFRACTELG
IRTVAVYSEQDTGQMHRQKADEAYLIGRGLAPVQAYLHIPDIIKVAKENNVDAVHPGYGF
LSERADFAQACQDAGVRFIGPSPEVVRKMGDKVEARAIAITAGVPVVPGTDAPITSLHEA
HEFSNTYGFPIIFKAAYGGGGRGMRVVHSYEELEENYTRAYSEALAAFGNGALFVEKFIE
NPRHIEVQILGDQYGNILHLYERDCSIQRRHQKVVEIAPAAHLDPQLRTRLTSDSVKLAK
QVGYENAGTVEFLVDKHGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHVAEGRSLPDL
GLRQENIRINGCAIQCRVTTEDPARSFQPDTGRIEVFRSGEGMGIRLDNASAFQGAVISP
HYDSLLVKVIAHGKDHPTAATKMSRALAEFRVRGVKTNIPFLQNVLNNQQFLAGTVDTQF
IDENPELFQLRPAQNRAQKLLHYLGHIMVNGPTTPIPVKANPSPTDPIVPVVPIGPPPAG
FRDILLREGPEGFARAVRGHPGLLLMDTTFRDAHQSLLATRVRTHDLKKISPYVAHNFSK
LFSIENWGGATFDVAMRFLYECPWRRLQELRELIPNIPFQMLLRGANAVGYTNYPDNVVF
KFCEVAKENGMDIFRVFDSLNYLPNLLLGMEAAGSAGGVVEAAISYTGDVADPSRTKYSL
QYYMGLAEELVRAGTHILCIKDMAGLLKPAACTMLVGSLRDRFPDLPLHVHTHDTSGAGV
AAMLACAQAGADVVDVAADSMSGMTSQPSMGALVACTRGTPLDTGVPLERVFDYSEYWEG
TRGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQAHSMGLGSKFKEVKKAYVEANQM
LGDLIKVTPSSKIVGDLAQFMVQNGLSRAEAEAQAEELSFPRSVVEFLQGYIGIPHGGFP
EPLRSKVLKDLPRVEGRPGASLPPLDLQALEKELTERHGEELTPEDVLSAAIYPDVFAHF
KDFTATFGPLDSLNTRLFLQGPKIAEEFEVELERGKTLHIKALAVSDLNRAGQRQVFFEL
NGQLRSILVKDTQAMKEMHFHPKALKDVKGQIGAPMPGKVIDIKVAAGAKVAKGQPLCVL
SAMKMETVVTSPIEGTVRKVHVNTDMTLEGDDLILEIE
NT seq 3537 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagttcagaaccgtccgggggggcctgacgctcctgggcatccgccgaacctcc
actgccccggccgcctccccacatgtccggcgcctggagtacaagcccatcaagaaagtc
atggtggccaacagaggtgagatcgccatccgcgtgttccgcgcctgcacagagctgggt
atccgtaccgtggctgtgtactcggagcaggacacgggccagatgcaccggcagaaagcc
gacgaagcctacctcatcggccgcggcctggcccctgtgcaggcctacctgcacatccca
gacatcatcaaggtggccaaggaaaacaatgtggacgcggtgcatcccggctacgggttc
ctgtcggagcgcgcagacttcgcccaggcctgccaggacgcgggggtccgcttcatcggg
cccagcccagaggtggtccgcaagatgggggacaaggtggaagcccgggccatcgccatc
actgcaggtgtccccgtagttcctggcacagacgcccctatcacttccctgcatgaggcg
cacgagttctccaacacctacggctttcccatcatctttaaggccgcctatggcggtggg
gggcggggcatgagggtcgtgcacagctacgaggagctggaggagaactacacccgggcc
tactcggaggctctggctgcttttgggaacggggcgctgttcgtggagaagttcattgag
aatccgcgtcacattgaggtgcagatcctgggggaccagtacgggaacattctgcacctg
tacgagagagactgttccatccagcggcggcaccagaaagtggtcgagattgcccctgcc
gcccacctagacccccagcttcggacccggctcaccagtgactctgtcaaacttgctaag
caggtgggctacgagaacgcgggcaccgtggagttcctggtggacaagcatggcaagcat
tacttcatcgaggtcaactcccgcctgcaggtggagcacaccgtcaccgaggagatcacc
gatgtggacctggtccacgcccagatccacgtggccgagggccggagcctgcctgacctg
ggcctgcggcaggagaatatccgcatcaacggctgtgccatccagtgccgggtcaccacc
gaggaccccgcacgcagcttccagccggacaccggccgcatcgaggtgttccggagtggg
gagggcatgggcatccgcctggataacgcttctgccttccaaggggctgtcatctccccc
cattacgactccctgctggtcaaagtcatcgcccacggcaaagaccaccccacagcggcc
accaagatgagcagagccctggccgagttccgagtccgaggcgtgaagaccaacatcccc
ttcctgcagaacgtgctcaacaaccagcagttcctggcaggcaccgtggacacccagttc
attgacgagaacccggagctcttccagctgcggcccgcgcagaaccgggcccagaagctg
ctgcactacctcggacacatcatggtgaatggcccgaccaccccgatccctgtcaaggcc
aaccccagtcccacggaccccattgtccctgtggtgcccataggcccgcccccggctggt
ttcagagacatcctgctgcgagaggggcccgagggctttgctcgagctgtgcggggccac
ccggggctgctgctaatggacacaaccttcagggatgcccaccagtcactgctggccact
cgcgtgcgaacccacgacctcaaaaagatctccccctatgtggcccacaacttcagcaag
ctcttcagcatagagaactggggaggggccacgtttgacgttgcaatgcgcttcctgtac
gagtgcccttggcggcgtctgcaggagctccgggagctcatccccaacatcccgttccag
atgttgctgcggggggccaatgccgtgggttacaccaactaccccgacaatgtggtcttc
aagttctgtgaggtggccaaggagaatggcatggacatcttccgggtctttgactccctc
aactacctgcccaatctcctgctgggcatggaggccgcaggcagtgctggtggcgtggtg
gaggccgccatctcctacacgggtgacgtggccgacccgagccgcaccaagtactcgctg
cagtattacatgggcttggccgaagagctggtgcgagctggcacccacatcctgtgcatc
aaggacatggcagggctgctgaagccagcggcctgcaccatgctggtcggctctctccgg
gaccgcttccctgacctcccgctgcacgtccacacccatgacacgtcaggggcaggcgtg
gcagccatgctggcctgtgcccaggctggggccgatgtggtggacgtggcagctgattcc
atgtccgggatgacttcacagcccagcatgggggccttggtggcctgtacccgaggcact
cccctggacacaggggtgcccctggagcgcgtgtttgactacagtgagtactgggagggg
acccggggactgtatgctgcctttgactgcacggccaccatgaagtctggcaactcggac
gtgtatgagaatgagatcccagggggccagtacaccaacctgcacttccaggcacacagc
atggggctgggctccaagttcaaggaggtcaagaaggcctacgtggaagccaaccagatg
ctaggcgatctcatcaaggtgacaccctcctccaagatcgtgggggacctggcccagttc
atggtgcagaacgggctgagcagggccgaggccgaggcccaggcagaagagctgtccttc
ccccgctccgtggtggagttcctgcagggctacatcggcattccgcacgggggcttcccg
gagccccttcgctccaaggtgctaaaggacctgccgcgggtggaggggcggcctggagcc
tccctccctcccctggatctacaggcactagagaaggagctgacagagcggcacggggag
gagctgaccccggaggacgtgctgtcagcggccatctaccccgacgtctttgcccacttc
aaggacttcactgccacctttggccccctggacagcctcaatacccgcctcttcctccag
ggacccaaaattgcagaggagtttgaggtggagctggagcggggcaagacactgcatatc
aaagccctggccgtcagtgacctgaaccgggctggccagcggcaggtcttcttcgagctc
aatggacagctgcgttccattctcgtcaaggacacacaggccatgaaggagatgcacttt
caccccaaggccctgaaggacgtgaaaggccagatcggggcacccatgcctgggaaggtg
atagacatcaaggttgctgcaggggccaaggtggctaaaggccagcccctgtgtgtgctc
agcgccatgaagatggagactgtggtgacgtcacccattgaaggcactgtccgcaaggtc
catgtaaacacagacatgacactggagggcgatgacctcatcctggagattgagtga

DBGET integrated database retrieval system