KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109453556Help
Entry
109453556         CDS       T04863                                 

Gene name
PLK2
Definition
(RefSeq) serine/threonine-protein kinase PLK2
  KO
K08861  polo-like kinase 2 [EC:2.7.11.21]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:rss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109453556 (PLK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rss01001]
    109453556 (PLK2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rss03036]
    109453556 (PLK2)
Enzymes [BR:rss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     109453556 (PLK2)
Protein kinases [BR:rss01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   109453556 (PLK2)
Chromosome and associated proteins [BR:rss03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    109453556 (PLK2)
   Centrosome duplication proteins
    Regulators of centriole replication
     109453556 (PLK2)
  Sister chromatid separation proteins
   Polo kinases
    109453556 (PLK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr POLO_box Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-GeneID: 109453556
NCBI-ProteinID: XP_019598906
Position
Unknown
AA seq 685 aa AA seqDB search
MELLRTITYQPAASTKMCEQALGKACGADSKKKRPQQTPEEPQPPQPQAQVPPAAPHHHH
HHSHSGAEISRIIVDPTTGKRYCRGKVLGKGGFAKCYEMTDLTNNKVYAAKIIPHSRVAK
PHQREKIDKEIELHRILHHKHVVQFYHYFEDKENIYILLEYCSRRSMAHILKARKVLTEP
EVRYYLRQIVSGLKYLHEQEILHRDLKLGNFFINEAMELKVGDFGLAARLEPLEHRRRTI
CGTPNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGRPPFETTNLKETYRCIREARYTMP
SSLLAPAKHLIASMLSKNPEDRPSLDDIIRHEFFLQGFTPDKLSSSCCHTVPDFHLSSPA
KNFFKKAAAALFGGKKDKARYIDTHNRISKEDEEIYKLRHDLKKTSITQQPNKHRTDEEL
QPPSTTVARSGTPAVENKQQIGDAIRMIVRGTLGSCSSSSECLEDSTMGSVADTVARVLR
GCLENMPAADCIPKEQLSTSFQWVTKWVDYSNKYGFGYQLSDHTVGVLFNNGAHMSLLPD
KKTVHYYAELGQCSVFPATDAPEQFISQVTVLKYFSHYMEENLMDGGDLPSVTDIRRPRL
YLLQWLKSDKALMMLFNDGTFQVNFYHDHTKIIICSQNEEYLLTYINEDRISTTFRLTTL
LMSGCSLELKNRMEYALNMLLQRCN
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggagctcttgcggactatcacctaccagccggccgccagcaccaagatgtgcgagcag
gcgctgggcaaggcttgcggcgcggactcgaagaagaagcggccgcagcagacccccgag
gagccgcagcccccgcagccccaggcgcaggtgccgccggcggccccgcaccaccatcac
caccactcgcactcgggggccgagatctcgaggattatcgtggaccccacgacggggaag
cgctactgccggggcaaagtgctgggaaagggtggctttgcaaaatgttatgagatgaca
gatttgacaaacaacaaagtctatgctgcaaaaattattcctcacagcagagtagctaaa
cctcatcaaagagaaaagattgacaaagaaatagagcttcacagaattcttcatcataag
cacgtagtgcagttttaccactactttgaagacaaagaaaacatttacattctcttggaa
tactgcagtagaaggtccatggctcatatcttgaaagcgagaaaggtgttgacagagccg
gaagtccgatactacctcaggcagattgtgtctggactgaagtaccttcatgaacaagaa
atcttgcacagagatctcaaactaggcaacttttttattaatgaagccatggaactaaaa
gttggagacttcggtttggcagccaggctggaacccttggaacacagaaggaggacaata
tgtggtaccccaaattatctctcccctgaagtcctcaataagcaaggacatggctgtgaa
tcagacatttgggctttaggctgtgtaatgtatacaatgttactaggaagacccccattt
gaaactacaaatctgaaagaaacttacaggtgcataagagaagcaaggtatacaatgccg
tcttcattgctggctcctgctaagcacttaatagctagcatgttgtccaaaaatccagag
gatcggcctagtttggatgacatcattcgacatgaattttttttgcagggcttcactcca
gacaaactttcttctagctgttgtcatacagttccagatttccacttgtcaagcccagct
aagaatttctttaagaaagctgctgctgctctttttggtggcaaaaaagacaaagcaaga
tatattgacacacacaatagaatttctaaagaagatgaagaaatttacaagcttaggcat
gatttgaaaaagacttcaataactcagcaacccaataaacataggacggatgaggagctc
cagccacctagcactacagtggccagatctggaacacccgcagtggagaacaagcagcag
attggagatgctatccggatgatagtcagagggactctcggcagctgcagcagtagcagt
gaatgtcttgaagacagtaccatgggaagtgttgcagacacagtggcaagagtccttcga
ggatgtttagaaaacatgccagcagctgactgcattcccaaagagcagctgagcacttcc
tttcagtgggtcaccaaatgggtcgattactctaacaaatacggctttgggtaccagctc
tcagaccacactgtaggtgtccttttcaacaacggtgctcacatgagcctccttccggac
aaaaaaacagttcactattatgcagagcttggccaatgctctgttttcccagcaacagat
gctcctgaacaattcattagtcaagtgacggtgctgaaatacttctctcattacatggag
gagaaccttatggatggtggagatctgcctagtgttactgatattcgaagacctcggctc
tacctccttcagtggctaaaatctgataaggccttaatgatgcttttcaatgatggcacc
tttcaggtgaatttctaccacgaccatacaaaaataatcatctgtagccaaaatgaagaa
taccttcttacgtacatcaatgaggacaggatatctacaacgtttagactgacaactctg
ctgatgtctggctgttcgttagaattaaaaaatcgaatggaatatgccctgaacatgctc
ttacagagatgtaactaa

DBGET integrated database retrieval system