KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109460673Help
Entry
109460673         CDS       T04863                                 

Gene name
MTHFR
Definition
(RefSeq) methylenetetrahydrofolate reductase isoform X1
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00670  One carbon pool by folate
rss01100  Metabolic pathways
rss01200  Carbon metabolism
rss01523  Antifolate resistance
Brite
KEGG Orthology (KO) [BR:rss00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    109460673 (MTHFR)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    109460673 (MTHFR)
Enzymes [BR:rss01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     109460673 (MTHFR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 109460673
NCBI-ProteinID: XP_019611853
Position
Unknown
AA seq 696 aa AA seqDB search
MDHPKPKVLPAGHHCPSLGMWALEAGSVRFSVPPSISRNSAMVNEPGGHGGPNPCLEGRS
IGRESSMVSSRCSTRGLKPEQRERLREKMRRRMESGDKWFSLEFFPPRLAEGVANLISGF
DQMGAGGPLFIDVTWRPAGDPGSDKETSSMTIASTAVNYCGLETVLHMTCCCQSQEKITC
HLHKAKRLGLKNILALRGDPVGDQWKEEEGGFCYAVDLVKHIRSEFGDYFDIGVAGYPKG
HPDAGSFESDLKFLKEKVSAGADFIITQLFFEADTFCQFFKACSEIGITCPILPGIFLIQ
NYHSLQQLVKLSKLEVPQQIKDKIEPIKDNDDAICNYGIDQAVSLCKKLLASGLVPGLHF
YTLNRTMAAMQVLKRLGMWTEDPRRFLPWAVSAHPKRWEEDVRPIFWASRPKSYIYRTQE
WDEFPKGRWGNSSSPAFGELTDYHLFYLKSACPKEELLKMWGEELNSEESVFEVFTHYLS
GEPNRNGCQVTCLPWNDKPLATDTGLMQEKLLRMNRRGVLTINSQPNINGQPSSHPVLGW
GPSGGYVFQKAYLEFFTSRKTVEALLQVLKKYEFRVNYHIVNVKGENITNAPELQPNAVT
WGIFPGREIIQPMVVDPVSFMFWKDEAFALWIKQWGKLYGEESPSQKIIQCIHDNYFLVN
LVDNDFPLDNCLWQVIEDTFELLDRPPQTDREMEAT
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atggaccatccaaaacccaaggtcctcccagccgggcaccactgcccctccctgggaatg
tgggcattggaggcgggcagcgtgaggttctctgtgccaccctccatcagcaggaactca
gccatggtgaacgaacctggagggcatggcggccccaacccctgcctggagggccgcagc
attggtcgtgagagctccatggttagttcgagatgttccacacggggtctgaagcctgag
cagcgtgaaagactgagggagaagatgaggaggaggatggaatctggtgacaagtggttc
tccctagaattcttccctcctcggcttgctgagggagttgccaatctcatctcaggattt
gaccagatgggggcaggcggccccctcttcatagacgtgacctggcgcccagcaggagac
cctggctctgacaaggagacctcctccatgacaattgccagcactgctgtgaactactgt
ggcctggagaccgtcctgcacatgacctgctgctgtcagagccaggaaaagatcacgtgc
catctgcacaaggctaagcgtctgggcctgaagaacatcttggcattgaggggagaccct
gtaggtgaccagtggaaagaggaggaaggaggcttctgctacgctgtagacttggtgaag
catatccgaagtgagtttggtgactactttgacatcggtgtggcaggttaccccaaaggc
caccccgacgcagggagctttgagtctgacctgaagttcttgaaggagaaggtttctgca
ggagccgacttcatcatcacccagcttttctttgaggctgacacgttctgccagtttttt
aaggcttgctccgagataggcattacctgccccatcctccccggaatctttcttatccag
aactaccactccctccagcagctcgtgaagctgtccaagctggaggtgccacagcagatc
aaggacaagatcgagccgattaaggacaatgatgatgccatctgcaactatggcatcgat
caggctgtgagcctgtgcaagaagctgctggcaagtggcttggtgccaggcctccacttc
tacaccctcaaccgcaccatggctgccatgcaagtgctgaagcgcctgggcatgtggacc
gaagaccccaggcgtttcctgccctgggctgtcagtgcccaccccaaacgctgggaggaa
gacgtgcgtcccatcttctgggcctccagaccaaagagttacatctaccgcacccaggag
tgggatgagttccccaagggccgctggggcaattcttcctctccagcctttggggagctg
acggactaccacctcttctacctgaagagcgcatgcccaaaggaggagctgctgaagatg
tggggggaggagctgaacagcgaagaaagtgtctttgaagtctttacgcactacctctcg
ggagagccaaaccggaatggctgtcaagtcacttgcctgccctggaatgacaagcccttg
gcaaccgacaccggcctgatgcaggagaagctgctgcgcatgaaccggcggggcgttctc
accatcaactcccagcccaacatcaacgggcagccatcttcccacccggtcttgggctgg
ggccccagcgggggctatgtcttccagaaggcctacttggagttcttcacttcccgcaag
acagtggaagcgcttctgcaggttctgaagaagtacgagttccgggttaactaccacatc
gtgaatgtgaagggtgaaaacatcaccaatgcccctgagctgcagcccaacgctgtcact
tggggcatcttccctgggcgagagatcatccagcccatggtggtcgatcctgtcagcttc
atgttctggaaggatgaagccttcgccctgtggatcaagcagtggggcaagctgtacggc
gaggagtccccatcccagaaaatcatccagtgtatccacgacaactacttcctggtcaac
ctggtggacaatgatttccccctggacaactgcctgtggcaggtgatagaggacacattt
gagcttctcgaccgcccacctcagactgacagagagatggaggctacgtga

DBGET integrated database retrieval system