KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109461386Help
Entry
109461386         CDS       T04863                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor isoform X1
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss04010  MAPK signaling pathway
rss04014  Ras signaling pathway
rss04015  Rap1 signaling pathway
rss04022  cGMP-PKG signaling pathway
rss04066  HIF-1 signaling pathway
rss04068  FoxO signaling pathway
rss04072  Phospholipase D signaling pathway
rss04150  mTOR signaling pathway
rss04151  PI3K-Akt signaling pathway
rss04152  AMPK signaling pathway
rss04211  Longevity regulating pathway
rss04213  Longevity regulating pathway - multiple species
rss04520  Adherens junction
rss04910  Insulin signaling pathway
rss04913  Ovarian steroidogenesis
rss04923  Regulation of lipolysis in adipocytes
rss04930  Type II diabetes mellitus
rss04931  Insulin resistance
rss04932  Non-alcoholic fatty liver disease (NAFLD)
rss04960  Aldosterone-regulated sodium reabsorption
Module
rss_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:rss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    109461386 (INSR)
   04015 Rap1 signaling pathway
    109461386 (INSR)
   04010 MAPK signaling pathway
    109461386 (INSR)
   04066 HIF-1 signaling pathway
    109461386 (INSR)
   04068 FoxO signaling pathway
    109461386 (INSR)
   04072 Phospholipase D signaling pathway
    109461386 (INSR)
   04022 cGMP - PKG signaling pathway
    109461386 (INSR)
   04151 PI3K-Akt signaling pathway
    109461386 (INSR)
   04152 AMPK signaling pathway
    109461386 (INSR)
   04150 mTOR signaling pathway
    109461386 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109461386 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109461386 (INSR)
   04923 Regulation of lipolysis in adipocyte
    109461386 (INSR)
   04913 Ovarian Steroidogenesis
    109461386 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109461386 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    109461386 (INSR)
   04213 Longevity regulating pathway - multiple species
    109461386 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    109461386 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    109461386 (INSR)
   04931 Insulin resistance
    109461386 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rss01001]
    109461386 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:rss04090]
    109461386 (INSR)
Enzymes [BR:rss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109461386 (INSR)
Protein kinases [BR:rss01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   109461386 (INSR)
CD molecules [BR:rss04090]
 Proteins
  109461386 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like DUF4476 B2
Motif
Other DBs
NCBI-GeneID: 109461386
NCBI-ProteinID: XP_019613149
Position
Unknown
AA seq 1378 aa AA seqDB search
MGAGGRRGAAAAPLLVAVATLLMGAVGHLYPGEVCPGMDIRNNLTRLHELANCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYSLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECL
GNCSEPDDPTKCVACRNFYLDGRCVDTCPPPYYHFQDWRCVNFSFCQDLHNKCKNSRRQG
CHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGC
TVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLHLIRGDTL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSYIRTSFDKILLKWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFS
DERRTYGAKSDIIYVHTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWE
RQAEDSELYELDYCLKGLKLPSRTWSPPFESEGSQKHNQSDYEESGGECCSCPKTDSQIL
KELEESSFRKTFEDYLHNVVFVPRKSSSGPGAEDSRPSRKRRALGDVGNGTTVIPTVADF
PNISLTSTPTSSEEHRPFEKVMNKESLVISGLRHFTGYRIELQACNQDSPEERCSVAAYV
SARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCV
SRRHFALERGCRLRGLPPGNYSVRVRATSLAGNGSWTEATYFYVTDYLDVPSNIAKIIIG
PLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVPR
EKISLLRELGQGSFGMVYEGNAKDIIKGEAETRVAVKTVNEAASLRERIEFLNEASVMKG
FTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMA
AEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPV
RWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDN
CPDRLTELMRMCWQFNPKMRPTFLEIVDLLKDDLHPSFPEVSFFHSEENKAPESEELEME
FEDMESVPLDRSSHSQREEDGGSSLGLKRNYEEHIPYTHMNGGKKNGRILTLPRSNPS
NT seq 4137 nt NT seq  +upstreamnt  +downstreamnt
atgggcgctgggggcaggcggggggcggccgctgcgccgctgctggtggctgtggccacg
ctgctgatgggcgccgtgggccacctgtaccctggagaggtgtgccctggcatggatatc
cggaacaacctcacgaggttgcacgagcttgccaactgctcggtcattgaaggacatttg
cagatactgttgatgttcaaaacgaggcctgaggatttccgagacctcagtttccccaaa
ctcatcatgatcaccgattacttgctgctattccgggtctacgggctggagagcctgaag
gacctgttccctaacctcacggtcatcaggggctcccgtctcttcttcaactacgcgctg
gtcatcttcgagatggttcacctgaaggagctcggcctctacagcctgatgaacatcacc
cggggttctgtccgcatcgagaagaacaacgagctctgctacctggccaccatcgactgg
tcacgcatcctggattcggtggaggataattacatagtgctgaacaaagacgacaacgag
gagtgtggggacatctgtccaggcaccgcgaagggcaagaccaattgccctgccaccgtt
atcaacgggcagtttgttgagcggtgttggactcacagccattgccagaaagtctgcccc
accatctgtaagtctcacggctgcaccgctgaaggcctctgctgccacagtgagtgcctg
ggcaactgctccgagcccgacgaccccaccaagtgcgtggcctgccgcaacttctatctg
gacggcaggtgtgtggacacctgcccacctccgtactatcacttccaagactggcgctgc
gtgaacttcagcttctgccaggacctgcacaacaaatgcaagaactctcggagacagggc
tgccaccagtatgtcattcataacaacaagtgcatccctgagtgtccctctggatacacg
atgaattctagcaacttgatgtgcactccgtgtctgggcccctgtcccaaggtctgtcac
ctcctagaaggcgagaagaccatcgactcggtgacgtctgcccaggagctgcgaggctgc
actgtcatcaatggaagccttatcatcaacattcgaggcggcaacaacctggcagctgag
ctagaggccaacctcggcctcattgaagaaatttcagggtatctgaaaatccgccgttcc
tatgcccttgtgtcactttccttcttccggaagttacatctgattcggggggataccttg
gaaatcgggaactactcattctatgccttggacaaccagaacctaaggcaactgtgggac
tggagcaaacacaacctcaccatcactcaggggaaactcttcttccattataatcccaaa
ctctgcttgtcggaaattcacaagatggaggaagtttcaggaaccaaggggcgccaggaa
aggaacgacattgccctgaagaccaatggggaccaggcatcctgtgaaaatgaattactt
aaattttcttatattcggacatcttttgataagatcttgctgaagtgggagccatactgg
cctcctgacttccgagacctcctggggttcatgctgttctacaaagaggccccttatcag
aatgtgacggagttcgatgggcaggatgcatgtggctccaacagctggacagtggtggac
attgaccctcccctgaggtccaacgaccctaagtcgcagaaccaccctggatggctgatg
cggggtttgaagccctggacccaatacgccatctttgtcaagaccttggttaccttttct
gacgaacggcgcacatatggggcaaagagcgacatcatctatgtccacacagatgccacc
aatccttctgtccccctggatcccatctcagtttctaattcctcatcccagattatcctg
aagtggaagcctccctctgatcccaatggcaacatcactcactacctggttttctgggag
aggcaggcggaagacagtgagctgtatgagctggattattgcctcaaagggttgaagctg
ccctcccggacctggtctccaccgttcgagtcggagggttcccagaagcacaaccagagc
gactacgaggagtctggcggcgagtgctgctcctgcccgaagactgactctcagatcctg
aaggagctggaggagtcctcgttcaggaagacgtttgaggactacctgcacaacgtggtt
ttcgtccccagaaaatcctcttcaggccctggtgctgaggacagtaggccgtcgaggaaa
cgcagggcccttggcgacgtgggaaatgggacgacagtcatacccacagttgcggatttc
cccaatatctccttgaccagcacgcccacgagctcggaggagcaccggccctttgagaaa
gtaatgaacaaagagtcgctggtcatctccggccttcgccacttcaccggctatcgcatt
gagctgcaggcttgcaaccaagattcccctgaggaaaggtgcagcgtggctgcctatgtc
agcgccaggaccatgcccgaagccaaggcagatgacattgtgggccccgtgacccatgaa
atcttcgagaacaacgttgttcacttgatgtggcaggagccaaaggaacccaatggtctg
attgtgctgtacgaagtgagttatcggcggtacggcgatgaggagctgcacctctgtgtc
tcccgcaggcattttgctctggagcggggctgcaggttgcgtgggctgcctccagggaat
tacagcgtgcgagtccgggccacctccttggcgggcaacggctcctggacggaagccacc
tatttctatgtgacagactatttagacgtcccatcaaatattgcaaaaattatcattggt
cccctcatctttgtcttcctcttcagtgttgtgattggaagtatttatctattcctgaga
aagaggcagccggatgggccactgggaccactgtatgcttcttcaaaccctgagtacctc
agtgccagcgatgtgttcccatgttctgtgtacgtgccggacgagtgggaggtgcctcgc
gagaagatcagcctcctgcgagagctgggccagggctccttcggcatggtgtacgagggc
aacgccaaggacatcatcaaaggggaggcggagacccgcgtggcggtgaagacggtcaac
gaggcggccagtctgcgtgagcggatcgagtttctcaacgaggcctccgtcatgaagggc
ttcacctgccatcacgtggtccgcctcctaggggtggtgtccaaagggcagccaacgttg
gtggtaatggagctgatggctcacggagacctgaagagctacctccgttccctgcggcct
gaagctgagaataaccccggccgccctcccccgactttgcaagagatgattcagatggca
gcagagatcgccgacgggatggcatacctgaacgccaagaagtttgtgcaccgggacctt
gcagctcgaaactgcatggtcgcgcatgattttaccgtcaaaatcggagactttggaatg
accagagacatctacgaaacggattactaccggaaagggggcaagggtctactccccgtg
cggtggatggcacccgaatccctgaaggacggggtcttcaccacttcttccgacatgtgg
tcctttggtgtggtcctttgggaaatcaccagcttggcagaacagccttaccaaggcctg
tctaatgagcaggtgttgaaatttgtcatggatggagggtatttggatcaacctgacaac
tgtccagatagactcactgaactcatgcgcatgtgctggcagttcaaccccaagatgcgg
ccgaccttcctggagatcgtcgacctgctcaaggacgacctgcacccaagctttccggaa
gtttccttcttccacagtgaggagaacaaggcacccgagagcgaggaattggaaatggag
tttgaggacatggagagcgtccccctggaccggtcctcacactctcagagggaggaggac
ggagggtcctcgttggggctgaagcggaattacgaggaacacatcccctacacccacatg
aatgggggcaagaaaaacggacgcatcctgactctgccacggtccaatccttcctaa

DBGET integrated database retrieval system