KEGG   Rummeliibacillus stabekisii: ATY39_03940Help
Entry
ATY39_03940       CDS       T04369                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
rst  Rummeliibacillus stabekisii
Pathway
rst00520  Amino sugar and nucleotide sugar metabolism
rst01100  Metabolic pathways
rst01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ATY39_03940
Enzymes [BR:rst01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     ATY39_03940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AMW98666
UniProt: A0A143HAW4
Position
834187..835347
Genome map
AA seq 386 aa AA seqDB search
MLNLKQTCLIKNVTIVNADERMDNYDVYIKDGVIQHIGRLIEIEADEVIDGVNQYLLPGF
IDMHIHGSAGSDAMDATPESLHIMAKSLLKEGTTSFLATTMTQSIDKIEEALKNLAVFKS
GKDEAEMVGVHLEGPFVSKKRAGAQPLEHIIPPQLSLFQRFQELSGYRIKEVTVAPETDG
GFEFVENVAKTGVVVSIGHSDATFEEVQKAVVLGVKQGTHLYNQMRPFHHRDPGVVGGTL
LLPEIQAEIIVDFIHSHQESVKLAYQMKGADHIILITDAMRAKGLPYGDYDLGGQLVHVT
ESGAHLENGALAGSVLKMDQALRNMKETTNCTLQELVAMTSFNAAKQLNLTGKGRIKEHY
DADLVLLDKDLKIQKTIKKGNVIKNL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatttgaagcaaacatgcctgataaaaaatgtaaccattgtaaatgccgatgaa
cgtatggacaattatgacgtctatataaaagatggggttattcaacacatcggtcgttta
atagagatagaagcagatgaagtgatagatggcgttaaccaatatcttcttcctggattt
atcgatatgcatatacatggatcagctggtagtgatgcaatggatgctacgccagaatcg
cttcatataatggcgaaatccctgctgaaagaggggacaaccagttttcttgcaactacc
atgactcaatcgattgacaagatagaagaagcacttaaaaatttagctgtttttaaaagt
gggaaagatgaagccgaaatggtcggcgttcacctggaaggtccgtttgtttcgaaaaaa
cgcgcgggtgcccagccgctcgagcatattattccaccccaattatcattattccaacgg
tttcaagaacttagcggataccggattaaagaagtaactgtagcaccagaaacagatggt
ggatttgaatttgtagagaatgtcgcaaagacaggcgttgtagtttctatcggtcattca
gatgcaacttttgaagaagtgcaaaaagcagtagttcttggcgtgaaacaaggaacgcat
ctttataatcaaatgcggcccttccatcatagggatccaggcgtggtaggaggtacattg
cttctgcctgaaattcaagcagagatcattgtcgatttcattcactcacatcaggaatca
gttaagcttgcttatcaaatgaaaggcgcagatcatattattttaattaccgacgcaatg
agagcgaaaggcttaccctatggtgactacgatttaggtgggcagcttgttcatgtcaca
gagagtggcgctcatttagagaatggcgcattggctggcagcgtattaaaaatggatcaa
gctcttcgaaatatgaaagaaacaaccaactgtacacttcaggaacttgtcgctatgact
tccttcaatgcggcaaagcaattgaatttgactggcaagggaagaatcaaagaacattat
gacgccgatctcgttttattggataaagacttaaagattcaaaagacgattaaaaaaggc
aacgtcattaaaaatctgtag

DBGET integrated database retrieval system