KEGG   Rummeliibacillus stabekisii: ATY39_08905Help
Entry
ATY39_08905       CDS       T04369                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
rst  Rummeliibacillus stabekisii
Pathway
rst00220  Arginine biosynthesis
rst01100  Metabolic pathways
rst01110  Biosynthesis of secondary metabolites
rst01130  Biosynthesis of antibiotics
rst01230  Biosynthesis of amino acids
Module
rst_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:rst00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    ATY39_08905
Enzymes [BR:rst01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     ATY39_08905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: AMW99566
UniProt: A0A143HDJ8
Position
complement(1804314..1805282)
Genome map
AA seq 322 aa AA seqDB search
MKLLDKSQLRTVTSLKGKDLLELGDCTSLEVSQLIELAVKLKKATKEGACPPLLEDKTLG
MIFEKSSTRTRVSFEVAMNQLGGKSMYMNANDLQLGRGESISDTGHVLSGYLEGIMIRAN
SHEKVVELAKHASIPVINGLTDLAHPCQALADLETIYEVKGTFKGLKLAYIGDGNNVVHS
LMNACAHVGMDLAIATPKGYEPNQDIMNEAKNIASANDCTILHTFEPIEAASNADIIYTD
VWTSMGQEDECEKRLQDFKEFQINDALVAHAKSDYIFMHCLPAHREEEVTSSIIDSSHSV
IYQQAENRLHAQKALLVSILAD
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgctggataagagtcaattgagaacagtcacgtcgttgaaaggtaaagatttg
ttggagttaggggattgcacaagtttagaagtaagccagcttatagagctggccgttaag
ctgaaaaaagcaacaaaagaaggcgcttgtcctccgttattagaagacaaaacgctaggg
atgattttcgaaaaaagttcgacgcgtacccgtgtttcctttgaggtagcgatgaatcag
cttggcggaaaaagtatgtatatgaatgcaaacgatcttcaacttggtcgtggtgagtcg
atttcagatacaggtcatgttctctcaggctatttagaaggcatcatgattcgggcaaat
tctcatgagaaagtagttgagcttgcaaaacatgcgtccattcctgttattaatggactt
acagacctagctcatccttgccaagccttagctgatttggagacaatttatgaagtgaaa
gggacattcaaaggacttaagcttgcctacataggcgatggcaataatgttgtccactca
ttaatgaatgcctgcgcacatgttgggatggatttagctattgccacaccaaaagggtat
gaacctaaccaagatatcatgaacgaggccaaaaacattgcatcagcaaatgattgtacc
attctgcatacgtttgaaccgattgaagcggcatcaaatgctgatatcatctataccgat
gtttggacttcaatggggcaagaagatgaatgcgagaaacgcctgcaagattttaaggaa
ttccaaataaatgatgcacttgttgcacatgctaaatccgattatatatttatgcattgt
ttgcctgcacatcgcgaagaagaagtgacttcgtctattattgatagcagccattctgtt
atctaccagcaagcggaaaatcgacttcatgcacaaaaagcattgcttgtctctatatta
gccgattaa

DBGET integrated database retrieval system