KEGG   Rummeliibacillus stabekisii: ATY39_10115Help
Entry
ATY39_10115       CDS       T04369                                 

Definition
(GenBank) sugar dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
rst  Rummeliibacillus stabekisii
Pathway
rst00030  Pentose phosphate pathway
rst01100  Metabolic pathways
rst01120  Microbial metabolism in diverse environments
rst01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ATY39_10115
Enzymes [BR:rst01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     ATY39_10115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase THF_DHG_CYH_C Polysacc_synt_2 SPOR SBP_bac_3
Motif
Other DBs
NCBI-ProteinID: AMW99762
UniProt: A0A143HDJ2
Position
2029699..2030484
Genome map
AA seq 261 aa AA seqDB search
MYTDLKGKVVVITGGSTGLGRAMAVRFGQEQSKVVINYYKSKDEALEVKKEIEAAGGQAI
TVQGDVTKEEDVMNLVQTAIKEFGTLDVMINNAGVENPSPSHELSLDNWNKVLDTNLTGA
FLGSREAIKYFVENDIKGNVINMSSVHEMIPWPLFVHYAASKGGIKLMSETLALEYAPKG
IRVNNIGPGAMNTPINAEKFADPVQRADVESMIPMGYIGKPEEVASVAAFLASSEASYVT
GITLFVDGGMTKYPSFQAGRG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
ttgtatactgatttaaaaggtaaagtagttgtcatcacaggtggatcaacaggtttagga
cgcgctatggccgttcgttttggacaagagcaatcaaaagtcgtaattaactattacaaa
agtaaagatgaagcattagaggtcaaaaaagaaatagaagcagcaggtggacaagccatt
actgttcaaggagacgtaaccaaagaagaagacgtcatgaatcttgtgcaaacggctatc
aaagagttcggtacattggacgttatgattaataacgcaggtgttgaaaacccatcacct
tcacatgagttatccttagataactggaacaaagtattagatacaaatttaacaggtgct
ttcttaggtagtcgtgaagccatcaagtattttgttgaaaatgatattaaaggaaacgtt
attaacatgtctagtgtgcacgaaatgatcccttggccattatttgttcactatgcagca
agtaaaggcggtattaaattaatgtctgaaactttagcccttgaatacgcgccaaaaggt
atccgcgtcaataatatcggaccaggtgccatgaatacaccaatcaacgcagaaaaattt
gctgatcctgtacaacgtgctgacgttgaaagcatgattccaatgggttacatcggtaag
ccagaggaagtggcatctgtagccgcatttttagcatcctcagaagcaagctatgtaaca
gggattaccttatttgtggatggcggtatgacaaaatatccttcattccaggctggacga
ggctaa

DBGET integrated database retrieval system