KEGG   Rummeliibacillus stabekisii: ATY39_16705Help
Entry
ATY39_16705       CDS       T04369                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rst  Rummeliibacillus stabekisii
Pathway
rst00071  Fatty acid degradation
rst00072  Synthesis and degradation of ketone bodies
rst00280  Valine, leucine and isoleucine degradation
rst00310  Lysine degradation
rst00362  Benzoate degradation
rst00380  Tryptophan metabolism
rst00620  Pyruvate metabolism
rst00630  Glyoxylate and dicarboxylate metabolism
rst00640  Propanoate metabolism
rst00650  Butanoate metabolism
rst00900  Terpenoid backbone biosynthesis
rst01100  Metabolic pathways
rst01110  Biosynthesis of secondary metabolites
rst01120  Microbial metabolism in diverse environments
rst01130  Biosynthesis of antibiotics
rst01200  Carbon metabolism
rst01212  Fatty acid metabolism
rst02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ATY39_16705
   00630 Glyoxylate and dicarboxylate metabolism
    ATY39_16705
   00640 Propanoate metabolism
    ATY39_16705
   00650 Butanoate metabolism
    ATY39_16705
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ATY39_16705
   00072 Synthesis and degradation of ketone bodies
    ATY39_16705
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ATY39_16705
   00310 Lysine degradation
    ATY39_16705
   00380 Tryptophan metabolism
    ATY39_16705
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ATY39_16705
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ATY39_16705
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ATY39_16705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rst04147]
    ATY39_16705
Enzymes [BR:rst01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ATY39_16705
Exosome [BR:rst04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ATY39_16705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III SpoVAD
Motif
Other DBs
NCBI-ProteinID: AMX00874
UniProt: A0A143HGM9
Position
3308741..3309946
Genome map
AA seq 401 aa AA seqDB search
MQKTVIIDGARTAFGKFGGSLSSLAASDLGGAAIKEALKRSNVDAEQVDEVIMGTVLQAG
QGQIPSRQAATKAGIPYTVKTETINKVCASGMRSVTLADQLIRLGEENVIVAGGMESMSQ
APYYLPKARFGYRMGDGAIVDGMVYDGLSCAFSPNHVHMGTYGDETAEKFGLTREAQDNW
SLRSHQNAIAAIEGGKLGEEIVAVSIPQRKGEPVVVDQDEAPRKDTSIEVLGKLRPAFTK
DSGTVTAGNAPGINDGACAVVVTSEQYAEKNGLKPLATILGHAEVGVEPNDFPQTPGLVI
NKLLEKTGKSLEEIDLFEINEAFAAVALASSKIANLDEEKVNVNGGAVALGHPIGASGTR
VILTLAYELRRRGGGIGIAAICSGGGQGDAIMIEVPTTEGY
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaaaaacagtgattattgacggagcacgtacagcgtttgggaaattcgggggaagt
ttaagttctttggcagcaagcgatctagggggcgctgctattaaagaagcattaaaacgt
tctaatgtagatgcagagcaagtagatgaagtcattatgggaacagtgttgcaagcaggg
caaggccaaataccttcgcgccaagctgctactaaagcaggtataccttacactgtaaaa
actgaaacaattaataaagtatgtgcatctggtatgcgcagtgtcacgcttgcagatcaa
ttaatacggcttggagaggaaaacgtaatcgtagcaggcgggatggagtcgatgtctcaa
gcgccgtattatttgccaaaagcacgattcggctaccgtatgggagacggagccattgtg
gacggcatggtttatgacggcctttcatgtgctttctcaccaaatcatgtacatatgggt
acatatggcgacgagactgcggaaaaatttggacttacaagagaagcacaagataattgg
tcattgcgtagccaccaaaatgctattgcggcaatagaaggcggtaaactaggcgaagaa
attgttgctgttagcattccacaacgaaaaggcgagccagtcgttgtcgaccaagatgaa
gcgccaagaaaagatacatccatcgaggtgcttggcaaattgagacctgctttcactaaa
gatagcggaacggttactgcaggtaatgctcctggcattaacgacggtgcatgtgcagtg
gtggtaacgagcgagcagtatgcagagaaaaatggcttaaaaccgttagcaactatttta
ggtcacgcagaggttggagtagaaccaaacgatttcccgcaaacaccaggattagttatt
aacaagctacttgaaaagacaggcaaatcattagaagaaattgacctttttgaaatcaat
gaagcatttgcggctgttgcacttgctagcagtaaaattgctaatttggatgaagaaaaa
gtcaatgttaacggcggcgctgtagcattaggccacccaatcggtgcgtcaggaacgcgt
gttattttaactcttgcatatgaattacgtcgccgcggtggtgggattggtatcgcagct
atctgttcgggcggtggccaaggagacgcgattatgatcgaagtaccgacaacggaggga
tactaa

DBGET integrated database retrieval system