KEGG   Rhodovulum sulfidophilum: NHU_00279Help
Entry
NHU_00279         CDS       T04143                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
rsu  Rhodovulum sulfidophilum
Pathway
rsu00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:rsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    NHU_00279
Enzymes [BR:rsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     NHU_00279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: BAQ67450
UniProt: A0A0D6AXT3
Position
265920..266729
Genome map
AA seq 269 aa AA seqDB search
MSFSIQGKTAIVTGAANGLGLAIARHFADRGANVMFADRDEPRLVDECGRNAEGDSAVRY
FAGDLRERLTIANLLSATIDAFDRIDILVNASRQMVLSDPLDPDNDGFDVMMEQNVMTSL
RLSQIVSRRMIRQAGEAGQTEGQAGAIVNMSSIAATRTHGELLAYSVSCAALEQLTRSMA
VALAPHRIRVNGVAFGSVMSASLQNILKDQPDYRSEIRNHTPLGRIAKASELSETVQFLS
SDAAQFMTGQILAVDGGRTLIDPVATPAH
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtccttctccatccagggaaagactgcgatcgtcaccggcgcggccaacgggctgggg
ctggccatcgcccggcatttcgccgatcgcggtgcgaatgtgatgttcgccgaccgagac
gagccccggcttgtcgatgaatgcggcaggaatgccgagggcgacagcgcggtgcgctat
ttcgcgggcgatctgcgcgagcggctgaccatcgccaacctgctctcggccaccatcgac
gccttcgaccggatcgacatcctggtcaatgccagccggcagatggtgctgtctgatccg
ctcgatcccgacaatgacgggttcgacgtgatgatggaacagaacgtgatgacctcgctc
aggctcagccagatcgtgtcgcggcggatgatccgtcaggcgggagaggccggccagacc
gagggtcaggcgggcgccatcgtcaacatgtcctcgatcgccgcgacccggacccatggc
gagcttctggcctattcggtcagctgcgcggcgctggaacagctgacccgctcgatggcg
gtggcgctggcgccgcaccggatccgggtcaatggcgtggcgttcggttcggtgatgtcg
gccagcctgcagaacatcctaaaggatcagccggattaccgcagcgagatccgcaaccac
acgcctctggggcgaatcgccaaggcctccgagctgagcgagacggtgcagttcctgtcc
tccgatgcggcgcagttcatgaccggccagatccttgccgtcgatggcgggcgcacgctg
atcgacccggtggccacccccgcgcactga

DBGET integrated database retrieval system