KEGG   Rhodovulum sulfidophilum: NHU_03054Help
Entry
NHU_03054         CDS       T04143                                 

Definition
(GenBank) anaerobic Mg-protoporphyrin IX monomethyl ester oxidative cyclase
  KO
K04034  anaerobic magnesium-protoporphyrin IX monomethyl ester cyclase [EC:1.21.98.3]
Organism
rsu  Rhodovulum sulfidophilum
Pathway
rsu00860  Porphyrin and chlorophyll metabolism
rsu01100  Metabolic pathways
rsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NHU_03054
Enzymes [BR:rsu01000]
 1. Oxidoreductases
  1.21  Catalysing the reaction X-H + Y-H = X-Y
   1.21.98  With other, known, physiological acceptors
    1.21.98.3  anaerobic magnesium-protoporphyrin IX monomethyl ester cyclase
     NHU_03054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: B12-binding Radical_SAM Fer4_12 Fer4_14 FYDLN_acid
Motif
Other DBs
NCBI-ProteinID: BAQ70198
UniProt: A0A0D6B4Z1
Position
complement(3178463..3180100)
Genome map
AA seq 545 aa AA seqDB search
MRIVFIHPNYKSGGAEIAGNWPPAWVAYLTGSLRVAGYDDITFIDAMTNDISEDEVRKQL
KALQPDVIATTSITPSIYAAERLMEIAKEEVPNAVRVLGGIHATFMFKQVLSEAPWIDVI
VRGEGEEIVVNLMNAIRDGKWPESRRDIKGLAFLDGDEIVATAAAPTIKDVDSIKPDWTI
LEWEKYIYIPLNCRVAIPNMARGCPFTCSFCSQWKFWRDYRIRDPKKVVDEIEDLVENHK
VGFFILADEEPTINRKKFIAFCQELIDRGLPDKVKWGINTRVTDILRDEELLPFYRQAGL
VHISLGTEAAAQLKLDQFNKETRVEDNKRAIQLLREADILTEAQFIVGMDNETEETLEET
FQLCWDWQPDLANWAMYTPWPFTPLFQELHNKVEVFDYSRYNFVNPIMKPEAMDRAQLLD
RVMHNYRRFYMRKALFHYPWRGNGFRRRYLLGCLKAFLKAGVGRSFYDLGKNNYWGPQSK
DKVHFDFDMSRKPAAAQIEDWESNADRAAQAAARRKSKDTSFKMPADDPSQVKACGGGDQ
QMEEV
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattgtctttattcatcccaactacaagtccggcggcgccgagatcgcgggcaac
tggccgccggcctgggtggcctatctcaccgggtcgctgcgggtggcgggatatgacgac
atcacgttcatcgacgcgatgaccaacgacatttccgaggacgaggtccgcaagcaactg
aaggcgctgcagcccgacgtcatcgcgaccacctcgatcacgccctcgatctacgcggcc
gagcggctgatggagatcgccaaggaagaggtgccgaacgcggtccgtgtcctcggcggc
atccacgcgaccttcatgttcaagcaggtcctgtccgaggcgccctggatcgacgtcatc
gtgcgcggcgagggcgaagagatcgtggtcaacctgatgaacgcgatccgcgacggcaaa
tggccggaaagccgccgcgacatcaaggggctcgccttcctcgacggtgacgagatcgtg
gcgaccgccgccgcgcccaccatcaaggatgtcgattcgatcaagcccgactggaccatc
ctcgagtgggaaaaatacatctacatcccgctgaactgccgggtcgcgatcccgaacatg
gcgcggggctgcccgttcacctgttcgttctgctcgcaatggaaattctggcgcgactac
cggatccgcgatcccaagaaggtggtcgacgagatcgaggatctggtcgagaaccacaag
gtgggcttcttcatcctcgccgacgaggaaccgaccatcaaccgcaagaagttcatcgcc
ttctgccaggagctgatcgaccgcggcctgcccgacaaggtcaaatggggcatcaacacc
cgggtgaccgacatcctgcgcgacgaggagcttctgcccttctaccgccaggcggggctc
gtccatatctcgctagggaccgaggcggccgcccagctcaagctcgaccagttcaacaag
gaaacccgggtcgaggacaacaagcgcgcgatccagcttctgcgcgaggccgacatcctg
accgaggcccagttcatcgtcggcatggacaacgagaccgaggaaacgctggaagagacc
ttccagctctgctgggactggcagcctgacctcgcgaactgggcgatgtacacgccctgg
cccttcacgccgctcttccaggaactgcataacaaggtcgaggtcttcgattacagccgc
tacaacttcgtgaacccgatcatgaagcccgaggcgatggaccgtgcccagcttctggac
cgggtgatgcacaactatcgccggttctacatgcgcaaggcgctgttccattacccctgg
cgcggcaacggcttccgccgtcggtacctgctgggctgcctgaaggcgttcctgaaggcg
ggtgtgggccggtccttctacgatctgggcaagaacaactactggggcccgcaatcgaag
gacaaggtgcatttcgatttcgacatgtcccgcaaacctgccgccgcgcagatcgaggac
tgggaatcgaatgccgaccgtgccgcccaggctgcggcccggcgcaagtccaaggacacg
agcttcaagatgcccgccgacgatccctcgcaggtgaaggcctgcggtggcggcgatcag
caaatggaagaagtctga

DBGET integrated database retrieval system