KEGG   Rhodovulum sulfidophilum: NHU_04472Help
Entry
NHU_04472         CDS       T04143                                 

Gene name
phbA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rsu  Rhodovulum sulfidophilum
Pathway
rsu00071  Fatty acid degradation
rsu00072  Synthesis and degradation of ketone bodies
rsu00280  Valine, leucine and isoleucine degradation
rsu00310  Lysine degradation
rsu00362  Benzoate degradation
rsu00380  Tryptophan metabolism
rsu00620  Pyruvate metabolism
rsu00630  Glyoxylate and dicarboxylate metabolism
rsu00640  Propanoate metabolism
rsu00650  Butanoate metabolism
rsu00900  Terpenoid backbone biosynthesis
rsu01100  Metabolic pathways
rsu01110  Biosynthesis of secondary metabolites
rsu01120  Microbial metabolism in diverse environments
rsu01130  Biosynthesis of antibiotics
rsu01200  Carbon metabolism
rsu01212  Fatty acid metabolism
rsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NHU_04472 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    NHU_04472 (phbA)
   00640 Propanoate metabolism
    NHU_04472 (phbA)
   00650 Butanoate metabolism
    NHU_04472 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NHU_04472 (phbA)
   00072 Synthesis and degradation of ketone bodies
    NHU_04472 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NHU_04472 (phbA)
   00310 Lysine degradation
    NHU_04472 (phbA)
   00380 Tryptophan metabolism
    NHU_04472 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NHU_04472 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NHU_04472 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NHU_04472 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rsu04147]
    NHU_04472 (phbA)
Enzymes [BR:rsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NHU_04472 (phbA)
Exosome [BR:rsu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NHU_04472 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAQ71585
UniProt: A0A0D6B9T0
Position
Plasmid2:29616..30797
Genome map
AA seq 393 aa AA seqDB search
MTSDPIVITGARRSPMGGFQGDLAAANAPALGATAIRAALGGLDPEAVEEILMGCVLPAG
QGQAPARQAALGAGLPLGAGATTVNKMCGSGMKAAMLAHDLIAAGSAQIAVAGGMESMSN
APYLLPKARGGYRMGHGEVKDHMFLDGLEDAYDRGRLMGTFAEDCAEAYQFTREAQDAYA
IASLDRANAAITEGRFRAEIAPVTLATRKGEQVIDTDEQPGKARPEKIPSLKPAFRKGGT
VTAANSSSISDGAAALVLMRASEAERRGLTPLAKILGHATHADKPSLFPTAPIGSIRKLM
ERTGLTLSEIDLFEVNEAFAVVAMAAIRDLGLSHDIVNVHGGACALGHPIGASGARVLVT
LLAALETHGLKRGVASLCIGGGEATAMAVERFA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacctccgatcccatcgtcatcaccggtgcccggcgcagccccatgggcggctttcag
ggcgatcttgccgctgcaaacgccccagcacttggcgccaccgcgatccgcgcggccctt
ggcgggctggaccccgaggcggtcgaggaaatcctgatgggctgcgttttgcccgcgggc
cagggtcaggccccggcccggcaggcggcgctgggggcgggcctgcccttgggcgcgggc
gccaccaccgtcaacaagatgtgcggctcggggatgaaggccgcgatgctggcccatgac
ctgatcgccgccgggtcggctcagatcgccgtcgcgggcgggatggagagcatgtcgaac
gcgccctatctgttgcccaaagcccgtggcggctaccggatgggccatggcgaggtgaag
gaccacatgttcctcgacgggctcgaggacgcctatgacaggggccggctgatgggcacc
ttcgccgaggattgcgccgaggcctaccagttcacccgcgaggcccaggacgcctatgcc
atcgcctcgctcgaccgcgccaatgccgccataaccgaaggccggttccgggccgagatc
gcgcccgtgaccctcgccacccgcaagggcgagcaggtgatcgacaccgacgaacagccc
ggcaaggcccgccccgaaaagatcccgtcgctgaaacccgccttccgcaagggcggcacc
gtgaccgcggccaacagctcgtcgatctcggacggcgccgccgcgctggtcctgatgcgc
gcctccgaggccgagcgtcggggcctgacgcccttggcgaagatcctcggccatgccacc
catgccgacaagccctcgctgttcccgaccgccccgatagggtcgatccgcaagctgatg
gagcgcaccgggctgacgctgtccgagatcgacctgttcgaggtcaacgaggccttcgcc
gtcgtcgccatggccgcgatccgcgatctcggcctctcgcatgacatcgtcaacgtccat
ggcggggcctgcgcgctcggccatcccatcggtgcctcgggggcgcgggttctggtcacg
ctgctggcggcgctcgagacccacggtctgaaacgcggcgtcgcctcgctctgcatcggc
ggcggcgaggccaccgccatggccgtggaaaggttcgcctga

DBGET integrated database retrieval system