KEGG   Rickettsia slovaca 13-B: Rsl_1306Help
Entry
Rsl_1306          CDS       T01671                                 

Gene name
paaJ
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rsv  Rickettsia slovaca 13-B
Pathway
rsv00071  Fatty acid degradation
rsv00072  Synthesis and degradation of ketone bodies
rsv00280  Valine, leucine and isoleucine degradation
rsv00310  Lysine degradation
rsv00362  Benzoate degradation
rsv00380  Tryptophan metabolism
rsv00620  Pyruvate metabolism
rsv00630  Glyoxylate and dicarboxylate metabolism
rsv00640  Propanoate metabolism
rsv00650  Butanoate metabolism
rsv00900  Terpenoid backbone biosynthesis
rsv01100  Metabolic pathways
rsv01110  Biosynthesis of secondary metabolites
rsv01120  Microbial metabolism in diverse environments
rsv01130  Biosynthesis of antibiotics
rsv01200  Carbon metabolism
rsv01212  Fatty acid metabolism
rsv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rsl_1306 (paaJ)
   00630 Glyoxylate and dicarboxylate metabolism
    Rsl_1306 (paaJ)
   00640 Propanoate metabolism
    Rsl_1306 (paaJ)
   00650 Butanoate metabolism
    Rsl_1306 (paaJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Rsl_1306 (paaJ)
   00072 Synthesis and degradation of ketone bodies
    Rsl_1306 (paaJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rsl_1306 (paaJ)
   00310 Lysine degradation
    Rsl_1306 (paaJ)
   00380 Tryptophan metabolism
    Rsl_1306 (paaJ)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rsl_1306 (paaJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rsl_1306 (paaJ)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Rsl_1306 (paaJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rsv04147]
    Rsl_1306 (paaJ)
Enzymes [BR:rsv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Rsl_1306 (paaJ)
Exosome [BR:rsv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rsl_1306 (paaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEV92625
Position
complement(1056199..1057377)
Genome map
AA seq 392 aa AA seqDB search
MTKPVYITYAKRTAFGSFIGSLSTTAAPMLAAHLIKDIMQNSKIDPALVGEVILGQVITG
GSGQNPARQTLIYAGIPKEVPGYTINKVCGSGLKSVVLAANSIMTGDNEIVIAGGQENMS
LGMHGSYIRAGAKFGDIKMVDLMQYDGLTDVFSGVFMGITAENISKQFNISRQQQDEFAL
SSHKKAAKAQLAGVFKDEILPIEVTIKKTTSLFDHDETVRPDISLEILSKLRPAFDKNGV
VTAGNASSINDGAACLMVVSEEALKKHNLTPLARIVSYASAGVDPSIMGTAPVPASKKAL
SKAGWSVNDLEVIEVNEAFAAQSIYVNREMKWDMEKVNVNGGAIAIGHPIGASGGRVLIT
LIHGLRRAKAKKGLVTLCIGGGMGMAMCVEAV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaccggtttatataacttatgcgaaaaggactgctttcggctcgtttataggt
agccttagtacaacggctgcacctatgcttgctgctcatttaataaaggatataatgcaa
aatagcaaaatcgatccagctttagtaggtgaggtaatccttggacaggtaataaccggc
ggtagcgggcagaatccggcgaggcaaactctgatttatgcgggaataccgaaagaagtg
ccgggctatacgattaataaagtatgcggctcaggtcttaaaagcgtagtacttgcagca
aattcaattatgacgggtgataatgaaatagttatagcaggtgggcaggagaatatgtcg
ctcggtatgcacggtagctatatcagagcaggagctaaattcggcgatattaaaatggtt
gatctaatgcagtatgacggattaaccgatgtattttcaggagtatttatgggtattaca
gccgaaaatatctcgaaacagtttaatattagcagacaacagcaggacgagtttgcctta
agctctcacaagaaagcagctaaagcacagctagcaggagtttttaaagatgaaatctta
cctatcgaagtaacgattaaaaaaactactagtttgtttgatcatgatgaaacagtaaga
cctgatatcagccttgaaattctgagtaaattacgtcctgcttttgataaaaacggtgta
gttacagcgggtaatgcttcctctattaatgacggtgcggcatgtcttatggtagtttcc
gaagaagctttgaaaaagcataatttaacgccgctagctcgtattgtttcttatgcttca
gccggtgttgatccaagtattatgggtactgcccctgttcctgcatccaaaaaagcttta
agtaaagcaggttggagcgttaatgatttggaagttatcgaggttaatgaggcgtttgcc
gctcaaagtatttatgtaaaccgtgaaatgaaatgggatatggagaaggttaatgttaac
ggtggagcaatagccatcggtcatccgatcggggcaagcggcggacgtgtacttattact
ctgatacacggcttacgcagagctaaagctaaaaaaggcttagttactttatgtatcggt
ggcggtatgggtatggctatgtgcgttgaagcggtttaa

DBGET integrated database retrieval system