KEGG   Rickettsia slovaca 13-B: Rsl_696Help
Entry
Rsl_696           CDS       T01671                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rsv  Rickettsia slovaca 13-B
Pathway
rsv00020  Citrate cycle (TCA cycle)
rsv00640  Propanoate metabolism
rsv01100  Metabolic pathways
rsv01110  Biosynthesis of secondary metabolites
rsv01120  Microbial metabolism in diverse environments
rsv01130  Biosynthesis of antibiotics
rsv01200  Carbon metabolism
Module
rsv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rsv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rsv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rsl_696 (sucC)
   00640 Propanoate metabolism
    Rsl_696 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Rsl_696 (sucC)
Enzymes [BR:rsv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Rsl_696 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AEV92219
Position
complement(591901..593061)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQAKEILRKYGVPTSTGLVVTKTEKINETIDKLNTEVYVVKAQIHAGGRGKAGGV
KVVKSKEEAKKVAHDMFGINLVTHQTGPQGQKVNRLYIESGCDILKEYYFSIVFDRSASC
ITFIASTEGGVDIEAVAEKTPDKIIKFSVDPATGLQDFHMRGIAYELGFKNNQAKQMKEI
VKSVYNAFIETDAAQIEINPLIVNSDGNLLALDAKITFDDNGLFRHPNITAMRDHDEEDP
LETRAANAGLSYVKMDGNIGCMVNGAGLAMATMDIIKLYGASPANFLDVGGGADRERVKE
ALKIILSDKEVQGILVNIFGGIMRCDIIAEGIIAAAKDIGIKVPLVVRLAGTNVEKGEEI
LSNSGLAIIPAHDLADAANKIVEAIR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgaatatcaagcaaaagagattttaagaaaatacggcgtacctacttcc
accgggctagttgttacgaaaaccgaaaagattaatgaaaccatagataaattaaatacg
gaagtatatgtggttaaagcacaaatacatgccggcggtagaggtaaagcaggcggtgtt
aaggttgttaagagtaaagaagaagccaaaaaagttgctcatgacatgtttggtattaat
ttagtaactcatcaaacaggacctcaaggacaaaaagtaaaccgtctttatatcgaatca
ggttgtgatattttaaaagaatattattttagtatagtatttgatagatcggctagctgt
attacttttatagcttctacagaaggaggagttgatattgaagcagtagcagaaaaaact
ccggacaaaattattaaattttccgttgatcctgcaaccggtttacaagattttcatatg
cgaggcatagcttatgagttaggctttaagaataaccaagctaaacagatgaaagaaata
gtaaaatcagtctataatgcttttattgaaaccgatgcagcacaaattgaaatcaaccca
ttaattgtaaatagcgacgggaacttattagctttagatgcaaaaattacttttgacgat
aacggcttatttcggcatccgaatattacggcaatgcgtgatcatgatgaagaagatcct
ctagaaactagagcagcaaatgcaggacttagctatgtaaaaatggacggtaatatcggt
tgtatggttaacggtgccggtcttgccatggccactatggatattattaaactttacggt
gcttcgcctgctaatttcttggatgtcggtggtggagctgatcgtgagcgtgtaaaagaa
gctttaaaaataattttatctgataaagaagtacaagggattctagttaatattttcggc
ggtatcatgcgttgtgatattatagcagaagggattattgccgctgcaaaagacataggt
ataaaagtaccgttagtagttcgtttagccggtacaaacgttgaaaaaggcgaagaaatt
ttatcaaattccggtttagcaataataccggcacatgatttagcagatgcggcaaataaa
atagttgaagcgatacggtag

DBGET integrated database retrieval system