KEGG   Rickettsia slovaca 13-B: Rsl_808Help
Entry
Rsl_808           CDS       T01671                                 

Gene name
pdhC
Definition
(GenBank) Pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rsv  Rickettsia slovaca 13-B
Pathway
rsv00010  Glycolysis / Gluconeogenesis
rsv00020  Citrate cycle (TCA cycle)
rsv00620  Pyruvate metabolism
rsv01100  Metabolic pathways
rsv01110  Biosynthesis of secondary metabolites
rsv01120  Microbial metabolism in diverse environments
rsv01130  Biosynthesis of antibiotics
rsv01200  Carbon metabolism
Module
rsv_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rsv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rsl_808 (pdhC)
   00020 Citrate cycle (TCA cycle)
    Rsl_808 (pdhC)
   00620 Pyruvate metabolism
    Rsl_808 (pdhC)
Enzymes [BR:rsv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Rsl_808 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 CAT QRPTase_N
Motif
Other DBs
NCBI-ProteinID: AEV92290
Position
680279..681499
Genome map
AA seq 406 aa AA seqDB search
MPALSPTMTEGNLARWLKKEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIVIPQNSQ
NVPVNSLIAVLSEEGEEKTDIDAFIAKNNSVSPSPKTDANLPKPHENIANVEEQVTVIKH
DASKIFASPLAKRLAKMRNIRFESVKGSGPHGRIVKQDILSYTPSTAHNKIVSRNPEEYR
LVPNNNIRKIIAKRLLESKQTVPHFYLSIECNVDKLLDIREDINKSFSEDKSTRISINDF
IILAVAKALQEVPNANASWGEDAIRYYNNVDISVAVAIEDGLVTPIVKNANQKNILELSR
EMKALIKKAKDNKLTPEEFQGGGFTISNLGMYGIKNFNAIINPPQSCIMGVGASAKRAIV
KNDQITIATIMDVTLSADHRVVDGAVGAEFLAAFKKFIESPVLMLI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctttatctccaactatgacggaaggaaatctagctaggtggttaaaaaaagaa
ggggacaaagttaatcctggagaagtaattgctgaaattgaaaccgataaagcaacgatg
gaagtagaagcagtagacgaaggtatacttgccaaaatagttatcccacaaaatagtcaa
aatgtacctgttaactctttaattgccgtgttaagtgaagagggagaagaaaaaacagac
attgatgcgtttattgcaaaaaataatagtgtatcaccgtcaccgaaaacagatgctaat
cttccgaaaccccacgagaatatagctaatgtagaagaacaggtaacagttataaaacat
gatgctagtaaaatattcgcctcaccgcttgcaaaaagacttgcaaaaatgagaaatatt
agatttgagagcgtgaaaggtagcggtccgcacggtagaatagtcaaacaagatatctta
tcatatactcctagcactgctcataataaaatagttagcagaaatcctgaagaatatcgt
ttagtaccaaataataatatccgcaagattatagccaagcgtctgcttgaatctaaacaa
acagttccacatttttatttatctatagaatgtaatgtcgataaattgttagatataaga
gaagacattaataaatctttttctgaagataaatcaacaaggatatcgattaatgatttt
attattttagcagtagccaaagctttacaagaagtgccaaatgccaatgctagctgggga
gaagatgcaattagatattacaataatgtcgatatttcagtagcggtagcgattgaggac
gggcttgttacaccaatagttaaaaatgccaatcaaaaaaacattctagaactatctcgt
gaaatgaaagcattaataaagaaagcaaaagataataaattaacccctgaagaatttcag
ggcggagggtttaccatttctaacctcggtatgtacggtattaagaatttcaatgctata
attaacccaccacaaagttgtataatgggcgtcggagctagtgcaaaacgtgctatagtc
aagaatgatcaaataactatagcaacaattatggacgtaactctttctgccgatcaccga
gtagtagacggagcagtcggtgctgagttcttggcagcatttaaaaagtttatagagagt
cccgttttgatgttgatataa

DBGET integrated database retrieval system