KEGG   Rickettsia slovaca D-CWPP: MC3_06015Help
Entry
MC3_06015         CDS       T01801                                 

Definition
(GenBank) Beta-glucosidase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
rsw  Rickettsia slovaca D-CWPP
Pathway
rsw00460  Cyanoamino acid metabolism
rsw00500  Starch and sucrose metabolism
rsw01100  Metabolic pathways
rsw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MC3_06015
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    MC3_06015
Enzymes [BR:rsw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     MC3_06015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Gp_dh_N
Motif
Other DBs
NCBI-ProteinID: AFD20079
UniProt: H8LNV7
Position
1002118..1003062
Genome map
AA seq 314 aa AA seqDB search
MTIRQMVKPVIIGISGPELTDAERELFEEHNPLGVVLFRRNIRKNDNGAQAKEALIKLIA
DIKEVLGENTIISIDQEGGRVQRLIAPTFYDAPAAQTFTDPQACKQNYSDIAKELREVGI
NLDFAPVADLLHEGADKIVGDRSFGGEPEVVVPLCLAAIDGLQEEKVGACIKHIPGHGRA
TVDSHKKLPIVDVDIEELAKTDFKVFKELAKHDNIKLAMTAHIIYKALDPENPATLSKKV
IDYIKNNIGFKGLIISDAIDMKALSGSMADVTKEVLDAGVDIVLECTGEFNKMSEVLCSV
SESSIDKFSDLFIA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacaataagacaaatggtaaagccagtaattataggtatatctggtcctgaattaacc
gatgccgaaagagaattatttgaagagcataatcctttaggtgtagttttattccgtcgt
aatattagaaagaatgataacggtgcgcaggctaaagaagcccttattaagcttattgca
gatataaaagaagtattaggggaaaatactatcatctctatagatcaagaaggcggtagg
gtacaaaggcttatagcaccgactttttatgacgctccggctgctcaaacttttactgat
ccccaagcatgtaaacaaaattatagtgatattgcgaaagagctgcgagaagtaggcatt
aatctagattttgcaccggtagcggatttgctccacgaaggagcagacaagatagtcggc
gatagaagtttcggcggggagccggaagtagtcgtgcctttatgtttagctgctatagac
ggattacaagaagagaaagtcggggcttgtataaaacatattccgggccatggtagagct
acggtggatagccataaaaaattaccgattgtcgatgttgatatagaagagttagcaaaa
acagactttaaagtatttaaggagctcgcgaagcacgataatattaaacttgctatgacg
gcacatataatttataaagctcttgatcctgagaatcctgccaccctatcaaaaaaagtg
atagactatattaaaaataatatcggctttaaagggcttattatttccgatgcaatagat
atgaaagctttaagcggtagtatggcagatgtgaccaaagaagttttagatgcaggcgta
gatatagtgcttgaatgtaccggagaatttaacaaaatgtctgaagttctatgtagtgtt
tcggaaagttctatagataaattttctgacttgtttattgcgtaa

DBGET integrated database retrieval system