KEGG   Rickettsia slovaca D-CWPP: MC3_06360Help
Entry
MC3_06360         CDS       T01801                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rsw  Rickettsia slovaca D-CWPP
Pathway
rsw00071  Fatty acid degradation
rsw00072  Synthesis and degradation of ketone bodies
rsw00280  Valine, leucine and isoleucine degradation
rsw00310  Lysine degradation
rsw00362  Benzoate degradation
rsw00380  Tryptophan metabolism
rsw00620  Pyruvate metabolism
rsw00630  Glyoxylate and dicarboxylate metabolism
rsw00640  Propanoate metabolism
rsw00650  Butanoate metabolism
rsw00900  Terpenoid backbone biosynthesis
rsw01100  Metabolic pathways
rsw01110  Biosynthesis of secondary metabolites
rsw01120  Microbial metabolism in diverse environments
rsw01130  Biosynthesis of antibiotics
rsw01200  Carbon metabolism
rsw01212  Fatty acid metabolism
rsw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rsw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MC3_06360
   00630 Glyoxylate and dicarboxylate metabolism
    MC3_06360
   00640 Propanoate metabolism
    MC3_06360
   00650 Butanoate metabolism
    MC3_06360
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MC3_06360
   00072 Synthesis and degradation of ketone bodies
    MC3_06360
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MC3_06360
   00310 Lysine degradation
    MC3_06360
   00380 Tryptophan metabolism
    MC3_06360
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MC3_06360
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MC3_06360
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MC3_06360
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rsw04147]
    MC3_06360
Enzymes [BR:rsw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MC3_06360
Exosome [BR:rsw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MC3_06360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFD20136
UniProt: H8LPU0
Position
complement(1057039..1058217)
Genome map
AA seq 392 aa AA seqDB search
MTKPVYITYAKRTAFGSFIGSLSTTAAPMLAAHLIKDIMQNSKIDPALVGEVILGQVITG
GSGQNPARQTLIYAGIPKEVPGYTINKVCGSGLKSVVLAANSIMTGDNEIVIAGGQENMS
LGMHGSYIRAGAKFGDIKMVDLMQYDGLTDVFSGVFMGITAENISKQFNISRQQQDEFAL
SSHKKAAKAQLAGVFKDEILPIEVTIKKTTSLFDHDETVRPDISLEILSKLRPAFDKNGV
VTAGNASSINDGAACLMVVSEEALKKHNLTPLARIVSYASAGVDPSIMGTAPVPASKKAL
SKAGWSVNDLEVIEVNEAFAAQSIYVNREMKWDMEKVNVNGGAIAIGHPIGASGGRVLIT
LIHGLRRAKAKKGLVTLCIGGGMGMAMCVEAV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaccggtttatataacttatgcgaaaaggactgctttcggctcgtttataggt
agccttagtacaacggctgcacctatgcttgctgctcatttaataaaggatataatgcaa
aatagcaaaatcgatccagctttagtaggtgaggtaatccttggacaggtaataaccggc
ggtagcgggcagaatccggcgaggcaaactctgatttatgcgggaataccgaaagaagtg
ccgggctatacgattaataaagtatgcggctcaggtcttaaaagcgtagtacttgcagca
aattcaattatgacgggtgataatgaaatagttatagcaggtgggcaggagaatatgtcg
ctcggtatgcacggtagctatatcagagcaggagctaaattcggcgatattaaaatggtt
gatctaatgcagtatgacggattaaccgatgtattttcaggagtatttatgggtattaca
gccgaaaatatctcgaaacagtttaatattagcagacaacagcaggacgagtttgcctta
agctctcacaagaaagcagctaaagcacagctagcaggagtttttaaagatgaaatctta
cctatcgaagtaacgattaaaaaaactactagtttgtttgatcatgatgaaacagtaaga
cctgatatcagccttgaaattctgagtaaattacgtcctgcttttgataaaaacggtgta
gttacagcgggtaatgcttcctctattaatgacggtgcggcatgtcttatggtagtttcc
gaagaagctttgaaaaagcataatttaacgccgctagctcgtattgtttcttatgcttca
gccggtgttgatccaagtattatgggtactgcccctgttcctgcatccaaaaaagcttta
agtaaagcaggttggagcgttaatgatttggaagttatcgaggttaatgaggcgtttgcc
gctcaaagtatttatgtaaaccgtgaaatgaaatgggatatggagaaggttaatgttaac
ggtggagcaatagccatcggtcatccgatcggggcaagcggcggacgtgtacttattact
ctgatacacggcttacgcagagctaaagctaaaaaaggcttagttactttatgtatcggt
ggcggtatgggtatggctatgtgcgttgaagcggtttaa

DBGET integrated database retrieval system