KEGG   Ralstonia solanacearum UY031: RSUY_17510Help
Entry
RSUY_17510        CDS       T06155                                 

Gene name
pitA
Definition
(GenBank) Low-affinity inorganic phosphate transporter 1
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
rsy  Ralstonia solanacearum UY031
Brite
KEGG Orthology (KO) [BR:rsy00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    RSUY_17510 (pitA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 FGGY_C
Motif
Other DBs
NCBI-ProteinID: ALF88091
UniProt: A0A072T1B2
Position
1867455..1868465
Genome map
AA seq 336 aa AA seqDB search
MHTLQISLWVVVLLVALAILFDFMNGFHDAANSIATVVSTGVLKPQQAVAMAAVCNVIAI
FIFHLKVATTVGRDTIDPSIVDHYVIFGALLGAIAWNIITWYYGIPSSSSHALIGGLVGA
AVAKSGTGSLVASGLLKTVAFILISPLLGFILGSCLMIAVSWLFFRTPPSKVDRWFRRLQ
LLSASLYSLGHGGNDAQKTIGIIWMLLIAGGYASATAHEPPIWVIVCCYVAIGLGTLLGG
WRIVRTMGQKITKLKPVGGFCAETGGALTLFLASAMGVPVSTTHTITGAIVGVGAAQKAS
AVRWGVAGNIVWAWVLTIPASAFMAAIAWWIGRQLL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcacacactccagatcagtctttgggtggtcgtcctgctggtggcgctggccatcctg
ttcgatttcatgaacggcttccacgatgcggccaattccatcgccacggtggtatcgacc
ggcgtgctcaagccgcagcaggccgtggcgatggccgcggtctgcaacgtgatcgccatt
ttcatctttcacctcaaggtcgcgacgacggtggggcgcgacaccatcgacccgagcatc
gtcgaccactacgtcatcttcggcgccctgctcggggcgatcgcctggaacatcatcacg
tggtactacggcattccgtccagctcgtcgcacgcgttgatcggcggactggtcggggcg
gccgtggccaagtcgggcacgggctcgctggtggccagcggtctgctcaagacggtggcg
ttcatcctgatttcgccgctgctggggttcattctcggctcgtgcctgatgatcgcggtg
tcctggctgttcttccgcacgccgccttccaaggtggaccggtggttccggcggctgcag
ttgctgtcggcctcgctgtacagcctgggccacggcggcaacgatgcgcagaagaccatc
ggcatcatctggatgctgctgatcgccggcggctatgcttcggcgacggcgcatgagccg
ccgatctgggtgatcgtctgctgctacgtggcgatcgggctgggcacgctgctgggaggc
tggcgcattgtccggaccatggggcagaagatcaccaagctcaagccggtgggcggtttc
tgcgctgaaaccggtggtgcgctgacgctgttcctcgcttcggcgatgggcgtgccggtt
tcgaccacgcataccatcaccggcgccatcgtcggcgtgggcgcggcgcagaaggcgtcg
gccgtgcggtggggcgtcgccggcaatatcgtctgggcctgggtcctgacgatcccggcc
tcggccttcatggcagcgatcgcctggtggatcggccggcaactgctttga

DBGET integrated database retrieval system