KEGG   Ralstonia solanacearum UY031: RSUY_17990Help
Entry
RSUY_17990        CDS       T06155                                 

Definition
(GenBank) 2-haloalkanoic acid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
rsy  Ralstonia solanacearum UY031
Pathway
rsy00361  Chlorocyclohexane and chlorobenzene degradation
rsy00625  Chloroalkane and chloroalkene degradation
rsy01100  Metabolic pathways
rsy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rsy00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RSUY_17990
   00361 Chlorocyclohexane and chlorobenzene degradation
    RSUY_17990
Enzymes [BR:rsy01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     RSUY_17990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 Put_Phosphatase
Motif
Other DBs
NCBI-ProteinID: ALF88139
UniProt: A0A072SPG7
Structure
PDB: 

Position
1921778..1922479
Genome map
AA seq 233 aa AA seqDB search
MTSIRAVVFDAYGTLFDVYSVAARAEQLFPGKGEALSVLWRDRQIDYTRIRSLAGPSGEH
YKPFWDVTVDALRYACARLGLALSAHHEATLMREYACLSAFPENVPVLRQLREMRLPLGI
LSNGNPQMLDIAVKSAGMSGLFDHVLSVDAVRQYKTAPAAYALAPQAFGVPAAQILFVSS
NGWDACGATWYGFTTFWINRLGHPPEALDVAPAAAGHDMRDLLQFVQARQSMR
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgattcgcgcggtggtgttcgatgcctatggcacgttgttcgacgtgtactcg
gtggccgcgcgcgccgagcagctgtttcccggcaagggcgaggcgctgtcggtgctgtgg
cgcgaccggcagatcgactacacccgcatccgctcgctggcgggaccctcgggcgagcac
tacaaaccgttctgggacgtcaccgtcgacgcgctgcgctatgcgtgcgcgcggctcggc
ctggcgctcagcgcccaccacgaggccacgctgatgcgcgaatacgcgtgcctgtcggcg
tttccggagaacgtgccggtgctgcggcaactgcgcgagatgcggctgccgctgggcatc
ctgtccaacggcaacccgcagatgctggacatcgcggtcaagagcgcgggcatgtcgggg
ctgttcgaccacgtgctgtcggtcgatgcggtgcggcaatacaagaccgcgccggccgcg
tacgcgctggcgccgcaggcgttcggcgtgccggccgcgcagattctgttcgtgtcgtcc
aacggctgggatgcctgcggtgcgacgtggtatggcttcacgacgttctggatcaaccgc
ctggggcatccgcccgaggcgctggatgtggcgcccgccgcggccggccacgacatgcgg
gacctgctgcagttcgtgcaggcccggcaatccatgcggtag

DBGET integrated database retrieval system