KEGG   Ralstonia solanacearum UY031: RSUY_25660Help
Entry
RSUY_25660        CDS       T06155                                 

Gene name
ywrD
Definition
(GenBank) Putative gamma-glutamyltransferase YwrD
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
rsy  Ralstonia solanacearum UY031
Pathway
rsy00430  Taurine and hypotaurine metabolism
rsy00460  Cyanoamino acid metabolism
rsy00480  Glutathione metabolism
rsy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    RSUY_25660 (ywrD)
   00460 Cyanoamino acid metabolism
    RSUY_25660 (ywrD)
   00480 Glutathione metabolism
    RSUY_25660 (ywrD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rsy01002]
    RSUY_25660 (ywrD)
Enzymes [BR:rsy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     RSUY_25660 (ywrD)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     RSUY_25660 (ywrD)
Peptidases and inhibitors [BR:rsy01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   RSUY_25660 (ywrD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: ALF88888
UniProt: A0A1C0UB44
Position
2747638..2749266
Genome map
AA seq 542 aa AA seqDB search
MPHRFVWQNPYPTVRVPLFARNVVSTSHPLAAQAGLRMLLAGGSAADAAIAAAAMLTIVE
PVSCGLGSDAFAILWDGERLHGLNASGTAPRGWSLDYFRRKYGEDAHGHPRRPTRGWDAV
TVPGAVSAWAALHARFGRLPFADVLEPAAEIAERGHAIAPIVAHKWAAAISELHNQPGYA
QTFMPYGRAPEVGEKFILRDAAATLRRIGETHGRDFYEGALAERIAAHAHACGGALTAQD
LRDHQPEWVAPIHQRYRGYDVHELPPNGQGIAALIALGILERFDLGALPVDSADSLHLQI
EAMKLAFADLYRYVADPRAMDVTPAQMLDDGYLDARARLIDMGRAGHPGFGMPRAGGTIY
LSAADERGMMVSFIQSNYMGFGSGVVVPGTGISLQNRGVGFSMDARSANVVEGGKRPFHT
IIPAFLMRDGAPVMSFGVMGGDMQPQGHLQTLVRMLDYRQQPQAACDAPRWKINRDFTLD
VEATLNADAVAGLRARGHRLKPVADPYMDFGSGQFIWRLSDDADRGYVAASDSRRDGHAV
GY
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgccccatcgcttcgtctggcagaacccctatcccaccgtgcgcgttccgctgttcgcg
cgcaacgtcgtatcgacctcgcatccgctggcggcgcaggcggggctgcgcatgctgctg
gccgggggcagcgcggccgatgcggcgatcgcggcggcggccatgctgaccatcgtcgag
ccggtatcgtgcggcctgggcagcgatgccttcgccatcctgtgggacggcgagcgcctg
cacggcctcaatgcatcgggcaccgcgccgcgcggctggagcctcgactacttccgccgc
aagtacggcgaagacgcccacggccaccccaggcgccccacgcgcggctgggatgcggtg
acggtgccgggcgccgtctcggcctgggccgccctgcacgcgcgtttcggcaggctgccg
ttcgccgacgtgctggaaccggcggccgagatcgcggaacgcggccacgccatcgccccc
atcgtcgcgcacaagtgggcggcggccatctccgagctgcacaaccagcccggctacgcg
cagacgttcatgccatacggccgcgcgcccgaagtgggcgagaagttcatcctgcgcgat
gcggccgccacgctgcgccgcatcggtgagacgcacggccgcgacttctacgaaggcgcg
ctcgccgagcgcatcgccgcgcatgcgcacgcctgcggcggcgcactgaccgcgcaagac
ctgcgcgaccaccaacccgaatgggtcgcaccgatccaccagcgctaccgcggctacgac
gtgcacgagctcccgcccaacggccagggcatcgcggcgctcatcgcgctgggcatcctc
gagcgtttcgacctcggtgccctgccggtcgattcggcggattcgctgcatctgcagatc
gaggcgatgaagctggcgttcgccgacctctaccgctatgtggccgacccgcgcgcgatg
gacgtcacgcccgcgcagatgctcgacgacggctacctcgacgcgcgcgcccggctcatc
gacatgggccgcgccggccatccgggcttcggcatgccgcgtgccggcggcaccatctac
ctgagcgcggcggacgagcgcggcatgatggtctcgttcatccagtccaactacatgggc
ttcggctcgggcgtggtggtaccgggcaccggcatcagcctgcagaaccggggcgtcggc
ttctcgatggatgcgcgctcggccaacgtggtggagggcggcaagcggccgttccacacc
atcatcccggcgttcctgatgcgggacggcgcgccggtgatgagcttcggcgtgatgggc
ggcgacatgcagccgcagggccatctgcagacgctggtgcgcatgctcgactaccggcaa
cagccgcaggccgcctgcgatgcgccgcgctggaagatcaaccgcgatttcacgctcgac
gtggaggccaccctgaacgccgacgccgtcgccggcctgcgggcgcggggccatcggctc
aagccggtggccgacccgtacatggatttcggctcgggccagttcatctggcgcctgtcc
gacgacgccgaccgcggctacgtggccgccagcgacagccgccgcgacgggcacgccgtc
gggtactga

DBGET integrated database retrieval system