KEGG   Ralstonia solanacearum UY031: RSUY_32920Help
Entry
RSUY_32920        CDS       T06155                                 

Gene name
acoA
Definition
(GenBank) Aconitate hydratase
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
rsy  Ralstonia solanacearum UY031
Pathway
rsy00640  Propanoate metabolism
rsy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    RSUY_32920 (acoA)
Enzymes [BR:rsy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     RSUY_32920 (acoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: ALF89603
UniProt: B5SAG8
Position
unnamed:complement(96952..99549)
Genome map
AA seq 865 aa AA seqDB search
MNTAHRKPLPGTSLDYFDAREAVEAIAPGAYDTLPYTSRVLAENLVRRCDPAMLADSLRQ
LIERKRERDFPWFPARVVCHDILGQTALVDLAGLRDAIADQGGDPAQVNPVVPVQLIVDH
SLAVECGGDDPDAFAKNRAIEDRRNEDRFHFIEWTKLAFKNVDVIPAGNGIMHQINLEKM
SPVIHAQDGVAFPDTLVGTDSHTPHVDALGVIAVGVGGLEAENVMLGRASWMRLPDIVGV
ELTGARQPGITATDIVLALTEFLRRQKVVGAYLEFYGEGASRLTLGDRATISNMAPEYGA
TAAMFSIDPQTLDYLRLTGRSDEQVKLVETYARTAGLWSDTLRHAAYERVLRFDLSAVVR
NMAGPSNPHARVATTELAAKGIAGRWDDVPGQMPDGAVIIAAITSCTNTSNPRNVIAAAL
LARNANRLGLARKPWVKSSLAPGSKAVALYLEAAGLKAELEQLGFGIVAFACTTCNGMSG
ALDPKIQQEIIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTVRFDIE
RDSFGTDANGKPITLKDLWPSDEEIDAIVRAAVKPEQFRQVYIPMFDQRSEATASVDPLY
DWRPQSTYIRRPPYWEGALAGERTLRGLRPLAVLGDNITTDHLSPSNAILASSAAGEYLA
GMGLPEEDFNSYATHRGDHLTAQRATFANPTLINEMAVVDGAVKKGSLARIEPEGKVTRM
WEAIETYMERKQPLIVIAGADYGQGSSRDWAAKGVRLAGVEAIAAEGFERIHRTNLIGMG
VLPLEFKPGTTRITLGIDGTETFDVVGARTPRADLTLVIHRSNGERVDVPVTCRLDTAEE
VSIYEAGGVLQRFAQDFLESAKEAA
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atgaataccgcacaccgcaaacccctgcccggcacgtcgctggactacttcgacgcccgc
gaggccgtcgaggccatcgccccgggcgcctacgacaccctgccctacacctcgcgcgtc
ctggccgagaacctggtgcgccgctgcgatccggccatgctcgccgattcgctgcggcaa
ctgatcgagcgcaagcgtgagcgggacttcccgtggtttccggcgcgcgtggtgtgccac
gacatcctgggccagaccgcgctggtggacctggccggcctgcgcgatgcgatcgccgac
cagggcggcgacccggcgcaggtcaacccggtggtgccggtgcagctgatcgtggaccac
tccctggcggtggaatgcggcggcgacgatcccgacgccttcgccaagaaccgcgccatc
gaagaccgccgcaacgaagaccgcttccacttcatcgagtggaccaagctggccttcaag
aacgtcgacgtgatcccggcgggcaacggcatcatgcaccagatcaacctggagaagatg
tcgccggtgatccacgcgcaggacggcgtggccttccccgacacgctggtcggcaccgac
agccacacgccgcacgtcgatgcgctgggcgtgatcgccgtcggcgtgggcggcctggag
gccgagaacgtgatgctggggcgcgcgtcgtggatgcgcctgccggacatcgtgggcgtg
gagctgaccggcgcgcgccagcccggcatcaccgccaccgatatcgtgctggcgctgacc
gagtttttgcgccgccagaaggtggtgggggcctacctggagttctacggcgagggcgca
tcgcgcctgacgctgggcgaccgcgccaccatctccaacatggcgcccgagtatggcgcc
acggccgcgatgttctcgatcgacccgcagacgctcgactacctgcgcctgaccggccgc
agcgacgagcaggtcaagctggtcgagacctacgccaggacggccggcctgtggtccgac
acgctcaggcacgcggcatacgagcgcgtgctgcgcttcgacctgtccgccgtcgtgcgc
aacatggccggcccgtcgaacccgcacgcgcgcgtggcgaccaccgagctggccgccaag
ggcatcgccggccggtgggatgacgtgccggggcagatgccggacggcgccgtcatcatc
gccgccatcaccagttgcaccaacaccagcaacccgcgcaacgtgatcgccgccgcgctg
ctggcacgcaatgccaaccggctgggcctcgcccgcaagccgtgggtgaagagttcgctc
gccccgggctccaaggccgtcgcgctgtacctggaagccgcgggcctgaaggccgaactg
gagcagctcggcttcggcatcgtcgcgtttgcgtgcaccacgtgcaacggcatgagcggc
gcgctggacccgaagatccagcaggagatcatcgaccgcgacctgtacgccacggccgtg
ctgtcgggcaaccgcaatttcgacggccgcatccacccgtatgcgaagcaggcgttcctg
gcttcgccgccgctggtggtggcctatgcgattgccggcacggtgcgcttcgacatcgag
cgcgacagcttcggcaccgatgcgaatggcaagcccatcacgctcaaggacctgtggccg
agcgacgaagagatcgacgccatcgtgcgcgccgcggtcaagcccgagcagttccgccag
gtctacatcccgatgttcgaccagcgcagcgaagccaccgccagcgtcgacccgctgtac
gactggcgcccgcagagcacctacatccgccgcccgccatactgggaaggcgcgctggcc
ggcgagcgcacgctgcgtggcctgcgcccgctggcggtgctgggcgacaacatcaccacc
gaccacctctcaccgtccaatgccatcctggccagcagcgccgccggcgaatacctcgcc
gggatgggcttgccggaagaggacttcaattcgtacgccacgcaccgcggcgaccacctg
acggcgcagcgcgcgaccttcgccaacccgacgctcatcaacgagatggccgtggtggat
ggcgcggtgaagaaggggtcgctggcgcgcatcgaacccgaaggcaaggtcacgcgcatg
tgggaagccatcgagacctacatggagcgcaagcagccgctgatcgtcatcgccggcgcc
gactacggccagggcagctcgcgcgactgggccgccaagggcgtgcgcctggccggcgtg
gaagccatcgccgccgagggcttcgagcgcatccaccgcaccaacctgatcggcatgggc
gtgctgccgctggagttcaagccgggcaccacgcgcatcacgctgggcatcgacggcacc
gagaccttcgacgtggtcggcgcacgcacgccgcgcgccgacctcacgctggtcatccac
cgcagcaacggcgagcgcgtggacgtgcccgtcacctgtcggctcgacaccgccgaggag
gtctcgatctacgaggcgggcggcgtactgcagcgcttcgcgcaggatttcctcgaatcg
gccaaggaggcggcatga

DBGET integrated database retrieval system