KEGG   Raphanus sativus (radish): 108805874Help
Entry
108805874         CDS       T06014                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz00260  Glycine, serine and threonine metabolism
rsz01100  Metabolic pathways
rsz01110  Biosynthesis of secondary metabolites
rsz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    108805874
Enzymes [BR:rsz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     108805874
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_3 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 108805874
NCBI-ProteinID: XP_018433360
Position
Unknown
AA seq 358 aa AA seqDB search
MVMRIVDLRSDTVTRPTDAMREAMASAEVDDDVLGYDPTARRLEEEMAKMMGKEAALFVP
SGTMGNLICVMVHCDVRGSEVILGDTCHIHVYENGGISTIGGVHPKTIKNEEDGTMDLVA
IEGAIRDPKGSTFYPSTRLICLENTHANSGGRCLSAEYTDRVGEIAKRHGLKLHIDGARI
FNASVALGVSVHRLVKAADSVSVCLSKGLGAPIGSVIVGSQSFIEKAKTLRKTLGGGMRQ
IGVLCAAALVALQENLPKLQSDHKKTKLLAEGLNKMKGIRVNVEAMETNMIFMDMEDGSR
LTAEKLRKSLTEHGILVIPENSSRIRMVIHHQITTSDVHYTLSCLQQAVQTIQEPCQN
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgagaatcgtggatctacgttcagacaccgtgacaagacccaccgacgcaatg
cgcgaagcaatggctagtgcagaggtggacgatgacgtcctcggctacgacccaacggct
cgacgtctcgaagaggagatggccaagatgatggggaaagaggcggctctgttcgtgcca
tccggtacgatggggaatctgatttgcgttatggttcattgcgacgtgagaggcagcgag
gtgattcttggggacacttgtcacatccatgtgtacgagaacggagggatatcgacaata
ggtggcgtgcatcccaagacgatcaagaatgaagaagatgggacaatggacttggtggct
atagaaggagccattagagatcctaaaggaagcacgttttatccatcaacaaggttgatt
tgtttggagaacacacatgccaactctggtgggagatgtttgagtgcggaatacacagat
agagttggagagattgctaagagacatggattgaagcttcatatcgatggagctcgcatt
tttaatgcttccgttgcacttggagtttcagtccatagacttgtaaaggctgctgactct
gtttcggtgtgtctctctaaaggtcttggagctccgataggatcagtaatcgttggttca
cagagtttcatagaaaaggcgaaaacattaaggaaaacattgggtggaggaatgagacag
ataggcgtcctgtgtgcagccgctttggtcgcactccaagagaacctgccgaagctacaa
tctgaccacaagaagacaaagttgttagctgaagggttgaacaaaatgaaagggattaga
gtgaacgttgaagccatggagaccaacatgatattcatggatatggaggatggatcaaga
cttaccgctgaaaaactccgcaagagtctaaccgagcatggcattctcgtcatccctgaa
aactcttcccggatcagaatggttatacaccaccagataacaacaagtgatgtgcattac
acattatcttgcttgcaacaagctgtgcagacgattcaggaaccatgccaaaactaa

DBGET integrated database retrieval system