KEGG   Raphanus sativus (radish): 108806139Help
Entry
108806139         CDS       T06014                                 

Definition
(RefSeq) beta-glucosidase 43
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz00460  Cyanoamino acid metabolism
rsz00500  Starch and sucrose metabolism
rsz00940  Phenylpropanoid biosynthesis
rsz01100  Metabolic pathways
rsz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    108806139
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    108806139
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    108806139
Enzymes [BR:rsz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     108806139
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 108806139
NCBI-ProteinID: XP_018433674
Position
Unknown
AA seq 500 aa AA seqDB search
MILFLLFLLLSASLSGQSSPSGDATGDLNRKSFPEGFVFGTATSAYQVEGETYQDGRGPS
IWDAFVKIPGKIANNATAELTVDQYHRYNEDVDLMQTLNFDAYRFSISWSRIFPEGTGKV
NWNGVAYYNRLIDYLVQKGITPYANLYHYDLPLALEKKYQGLLGRQVVDDFADYAEFCFK
TFGDRVKNWMTFNEPRVVAALGYDNGIFAPARCSKAFGNCTEGNSATEPYIVAHHLILAH
ASAVQRYRQHYQEKQKGRIGILLDFVWFEPLTSSEADNDAAQRARDFHLGWFIHPIVYGE
YPKTMQDIVKERLPEFTEEEVKMVKGSIDFVGINQYTTYYMSAPSPTTNPKDLGYQQDWN
VIFNFAKNGKPIGPRAHSEWLYNVPWGMYKAMMYVKEHYGNPTMILSENGMDDAGNITQP
QGVNDTTRITYYRDYLTQLKKAVDDGANVTGYFAWSLLDNFEWLSGYTSRFGIVYVDYKD
LKRYPKMSALWFRRLLKRDQ
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgattctttttctcctcttcctcctcctctctgcttcgctctccggccaatcttcgccg
tccggagatgccaccggtgatcttaacagaaaaagttttccggaggggttcgtgttcgga
accgccacgtcagcatatcaggtcgaaggcgagacctaccaagacggtcgtggcccaagc
atctgggatgcctttgtcaagattcctggcaagattgctaacaatgccacggctgaatta
acagttgaccagtatcaccgttacaatgaagatgtagatttgatgcagacactgaacttc
gatgcttacagattttcaatttcatggtccagaatattccctgagggaaccggtaaagtc
aactggaatggagttgcttattacaacagattgatcgattacttggtccaaaaagggatt
acaccgtatgcgaatctgtaccactacgaccttcctctggctttggaaaagaagtaccaa
ggcttgcttggtagacaagttgtggatgattttgcggattacgctgagttttgtttcaag
acatttggagatagagtcaagaactggatgacattcaacgagccacgtgttgtagctgct
ttaggttatgataacggtattttcgcaccggctagatgctctaaagcctttggaaactgc
actgaaggaaactctgccactgaaccttacattgttgcacatcaccttatcttggcgcat
gcatcagccgtccagagataccgccaacactatcaggagaagcaaaagggaaggattggt
attcttcttgatttcgtttggttcgagcctcttacgagtagtgaagcagacaatgatgct
gctcaaagagcaagagacttccatctcggatggttcattcacccaatagtatatggagag
tatccaaagacgatgcaggacatagtgaaggagaggcttccggaattcacggaggaggaa
gtgaagatggtgaaaggttccatagattttgtgggaataaaccaatacacgacttattac
atgtccgctccaagtcccacaaccaaccctaaggatttgggctatcaacaagattggaac
gtcatttttaactttgcaaagaatgggaagccaattggtccaagggcacattcagaatgg
ttgtacaacgtaccatggggaatgtacaaggccatgatgtacgttaaggaacattatggc
aaccctactatgattctctccgaaaatggtatggatgatgcgggcaacattactcaacct
caaggagtcaatgacacaacaagaatcacgtattatagagactacttgacgcagcttaaa
aaggccgtagacgatggagccaatgtaactggatattttgcgtggtcgttgcttgataat
ttcgaatggttatctggatatacttcaaggtttggaattgtgtacgttgactacaaggac
ttgaagcgatatcccaagatgtctgctttgtggtttagacgtcttttgaaacgggaccag
tga

DBGET integrated database retrieval system