KEGG   Raphanus sativus (radish): 108806305Help
Entry
108806305         CDS       T06014                                 

Definition
(RefSeq) serine/threonine-protein kinase-like protein At3g51990
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
rsz  Raphanus sativus (radish)
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rsz01001]
    108806305
Enzymes [BR:rsz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108806305
Protein kinases [BR:rsz01001]
 Serine/threonine kinases: TKL group
  IRAK family
   108806305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase PIP49_C Pkinase_fungal Haspin_kinase APH FTA2 Kinase-like
Motif
Other DBs
NCBI-GeneID: 108806305
NCBI-ProteinID: XP_018433881
Position
Unknown
AA seq 362 aa AA seqDB search
MGYLSCRAGSAVAVAVSSSSSSSKSLSTKPPPESPPEDRPKLRRFLHRDLEAATGGFSAD
NLLGRGSHGRVYKAAIGSSASSRLVAVKRPSKSREISREFHNEFEILSRIRSPRFVNLLG
YSADDPKDPLLVVEFMLNGSLYDVIHSDSPSAPAISSWSKRIKIALQIAKAVHLLHSQDP
PIVHRDIKSANVLMDKSLNAKLGDFGLAIRCNAEDQRVKSTPPAGTMGYLDPDYVTADRL
STKTDVFSFGILLLEIISGRKAIDVRYSPSFIVDWAIPMIKRGKIGGIYDPVIGPPVDVS
VRNHLGLVAAKCVRTCREKRPGMEEVVGWLTGLTQSVRSRRWDELGIGNPCMMVETVGRP
VE
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgggttacctctcgtgcagagccggatccgccgtcgcagtcgccgtctcatcctcctcc
tcctcctccaaatccctctccaccaaaccccctcccgaatctcccccagaagaccgtccc
aaactccgccgtttcctccaccgcgacctcgaagccgccacaggcggcttctccgccgac
aacctcctcggacgcggcagccacggccgcgtctacaaagccgccatcggctcctccgcc
tcctcccgcctcgtcgccgtcaagagaccttcgaaatcccgagagatcagccgcgagttc
cacaacgagttcgagatcctctccaggatccgaagccccaggttcgtcaacctcctcggc
tacagcgccgacgaccccaaggaccctctcctcgtcgtcgagttcatgctcaacggaagc
ctctacgacgtgatccactccgattcaccttccgcccccgcgatatccagctggagcaag
aggatcaagatcgctctccagatagccaaagccgtgcacctcctccactcgcaggacccg
ccgatcgtgcacagagacatcaaatccgccaacgttctcatggacaagagcctgaacgcg
aagctgggagacttcgggttggcgatcagatgcaatgcggaggaccagagagtgaaatcc
acccctccagctggcaccatggggtacctcgacccggactacgtcacggcggataggctg
agcaccaagactgacgtgttcagcttcgggatcttgctgctggagataatcagcgggagg
aaagcgatagacgtgaggtactcgccgtccttcatagtggactgggcgattccgatgatt
aagagagggaagatcggggggatttatgatccggtgatcgggcctcccgtggatgtgagc
gtgaggaatcatttggggttggtggcggccaagtgtgtgaggacgtgtagggagaagagg
cccgggatggaggaagtggttgggtggctcacggggttgacgcagtccgttaggtcgcgg
cggtgggatgagttgggcattgggaacccgtgtatgatggttgagaccgtgggcaggccc
gtggaatga

DBGET integrated database retrieval system