KEGG   Raphanus sativus (radish): 108810169Help
Entry
108810169         CDS       T06014                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase-like
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz00601  Glycosphingolipid biosynthesis - lacto and neolacto series
rsz00603  Glycosphingolipid biosynthesis - globo and isoglobo series
rsz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    108810169
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    108810169
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rsz01003]
    108810169
Enzymes [BR:rsz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     108810169
Glycosyltransferases [BR:rsz01003]
 Glycan extension
  P blood group
   108810169
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Arena_ncap_C Caps_synth
Motif
Other DBs
NCBI-GeneID: 108810169
NCBI-ProteinID: XP_018437800
Position
Unknown
AA seq 396 aa AA seqDB search
MDNVIAKKVTVMFNHRRLNRSPSSLFTASAASVISLIVFTIFIVSHVLVRDFTEVVTIEI
KTVVPYLPLRSEREQTNYTITVKEDNNLHVLEAFGGRDEKFQQRATEFLRDDCEVNFMMT
WISPAVMFGKREVLSVESVFKSHPKGCLIILSSTMDSPLGFRILKPFLDRGYRVTPITPD
LPFLLKDTAGETWLEEIQTGKRDPGKISLAQNLSNLMRLAYLFKFGGVYLDTDMIVLKSF
KHLRNVIGAQTLEPVSRNWTRLNNAVLIFDKNHPLLLRCIQEFALTFNGNVWGHNGPYLV
SRVARSVEGTDGYNFTVMTPSAFYSVNWVEIEKLFKVPRTEKDLKRVQVKVLEMQRRSYG
LHLWNKFSSKFEIEQGSAMDKIVSDHCVICDKVTAS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggataacgtcatcgccaagaaagtcacggtgatgttcaatcaccggcggttaaaccgc
tcaccatcatcactcttcacagcgtctgccgcctcggtcatatctctcatcgttttcacg
atcttcatcgtctctcatgtactggttagagacttcacagaggttgtgacgatagagatc
aagacagttgttccttacttacctctgaggtcagagagagagcaaactaactatacgatc
acagtcaaggaggataacaatcttcacgttctcgaggcttttggaggcagagacgagaag
tttcagcagagagcaacagagtttttgagagatgattgtgaggtcaacttcatgatgacg
tggatctctcccgcggttatgttcggtaagagagaggttttgtcggtagaaagcgtgttt
aagtctcatcctaaaggctgcttgatcattttatcttcaacgatggattctcctctaggg
tttagaatcttgaaaccgtttcttgatcgtggttacagagttacacctataactcctgac
ttgcctttcctgctcaaggacacggcaggagaaacatggctcgaggagattcagacaggg
aaaagagatcctggaaagatctctttagctcagaacctctcgaacctcatgagactcgcg
tacttgttcaagttcggaggtgtttatctagacactgacatgattgttcttaagagtttc
aaacacttgaggaacgtgatcggtgcgcagactctcgaaccggtttcgagaaactggacg
agattaaacaatgcggttttgatattcgacaagaaccatcctctcttgctcagatgcatt
caagagttcgcgttgactttcaacggaaacgtttggggacataacggaccgtaccttgtc
tctagagtggctcggtccgtggaaggaaccgatgggtataacttcaccgtcatgacacct
tctgcgttttattcggttaattgggttgagattgagaagctcttcaaggttccaagaaca
gagaaggacttgaagagagttcaagttaaggttcttgagatgcagaggagaagctacggg
ttgcatttgtggaataagtttagtagtaagtttgaaatcgaacaaggtagtgcgatggat
aaaattgtttcagatcattgtgttatatgtgacaaagtcactgcatcataa

DBGET integrated database retrieval system