KEGG   Raphanus sativus (radish): 108811365Help
Entry
108811365         CDS       T06014                                 

Definition
(RefSeq) protein HASTY 1-like
  KO
K14289  exportin-5
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz03013  RNA transport
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    108811365
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rsz03016]
    108811365
   03036 Chromosome and associated proteins [BR:rsz03036]
    108811365
Transfer RNA biogenesis [BR:rsz03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    108811365
Chromosome and associated proteins [BR:rsz03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     108811365
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1
Motif
Other DBs
NCBI-GeneID: 108811365
NCBI-ProteinID: XP_018438918
Position
Unknown
AA seq 1122 aa AA seqDB search
MLMKEDLVKGKDMIEAESETKTLARTVARQILLVVSDSSSSHSTVDEAALTSIESIKTGN
VEVLSQVSFLLVEKVWPLQVRIYASKMLQYLVKLRWDELCSSEQMDISSASFELMSEVAS
DPCEECGMKSETITLVAEMFEKEDLEMWQELFLSLVSLSSQGPLQAELALGVVKRLSEHH
IDYIKEELEDNKHRHHLLQGLPDILVWLHDLLEKHFGDARNAEAREKVELAKQHSDAVIA
CLNAINSLTEWAPVPYFAEYKIVDQCASLLSSSEFCRLACMFFKLICSRERPTDATSGAE
FDSTIIRICKMMVSLGSTNFQCIFTDSIAIALFLEQMLGFFEHYKFDLHYESLFFWLGLM
DYLTSDLNAPNYPHRKGAASEVFTGSASEIFNSFRHLDGGKKDILLLIDDELASKILDVS
FQRLNKNEIPDGTNLSLEPSKFEYQEFCQYQKRLIVLIRLISSHKPIIGTTKLSSRTVIL
IKNISVSSAPAIHYAAALKGLSTALESILRRLFRDSSQVHSQLHEIFEGLFQEVLNANFT
EPLIISAHVEYLNAMVPIIKSSPDAVGSVIDKMFALLTSLPPASKRARLYICLSLTRLAK
AADKSFTPHLKGLADKMTRLQREGAFLPGEHSSLVEAFFAMTSASGAQTQQQDSFALLLE
PVREQWTQPEWQNEYLSTPSGFIQLCSNAPLMQSIVNTVAVFKQALTGCTFKKRKLNMSE
TIHPLACHLSWMLPPLLKLFRVINSLSSPAVYQTLPTKLQTAMKIAEAELRSDKGNQSRK
LTKALFTCSSGGNANDIRNWLRAIRDTGYRVLNLSVAMGETFYTSIDANEVAAAFTENIC
WMEFRHIKLLINSFVGPLVISCPADKWESLLEPLLSPLLTHCQRALDSSWTSLLREGRAN
VPDLRSFEGGETKLIQLERQLLIDLSRSTSDLLSKISAPELNTGLPSLMKHSDQLVHGET
SLLKDFDSLKSNSLVSLLLSCRDLADSVMQFSLQACTWRDGITTFNLRCFFISVIQLAIT
TNNGELREFVAKDLFNALIMSLTIDENVNNSSVLVGLCSEIFVYLSPRHPAPRQVLLSLP
CLTPDDLREYEKALAETSEPKKQKQITRSMLSLALGINIKTD
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atgctgatgaaggaggatcttgtgaaaggaaaagatatgatagaagctgagtcagaaaca
aagactctcgctagaaccgtggctcgacagattctactcgtcgtctctgattcttcttct
tctcactccactgttgatgaagccgctctaacatccattgaatcgattaagacaggtaat
gttgaggttctgtctcaagtttcgtttcttcttgtggaaaaggtttggcctttacaagtt
cgcatctatgcctctaagatgctacagtatttggttaaactgcggtgggatgagttatgc
tcctctgagcagatggatattagtagtgcctcctttgaactcatgtctgaggtagcttct
gatccatgtgaagaatgtgggatgaaaagtgaaactatcactcttgttgctgagatgttt
gaaaaggaagatcttgagatgtggcaggagttgtttctctcactagtttccctctcctct
caaggccctttacaggcagaattggctttgggagtggtgaagaggctttctgaacatcat
atagattatattaaggaggagttggaagacaataagcataggcatcatctgttgcaggga
cttcctgatattttggtttggttgcatgatcttcttgaaaaacactttggggatgcaagg
aatgcagaagcgagagagaaagttgagctggctaaacagcattcagatgcagtcattgct
tgtttgaatgccatcaactcactcacagaatgggctccggttccatattttgctgaatac
aaaattgttgaccagtgtgcatccttactttcttctagtgagttctgccgtcttgcttgt
atgttcttcaaacttatctgctcaagagaaagaccaactgatgctacttctggtgctgaa
tttgattctacaatcatacgtatctgtaaaatgatggtctctctaggctccacaaacttc
cagtgcatcttcacagatagcattgccattgctctttttctggaacagatgcttggtttt
ttcgaacactataagtttgatcttcactatgagtcactgttcttctggctagggttgatg
gattatttaacctcagacctcaatgctcctaattacccacatagaaagggagcggcaagc
gaggttttcacgggatcggcaagcgagattttcaatagttttagacacctcgacggcggc
aaaaaggatattttactccttatagacgatgaactcgccagcaagattcttgacgtttcg
ttccaacgcttgaataagaacgagattcctgatggaacaaacctttcacttgagccatca
aagtttgaatatcaggagttttgccagtaccagaagaggctcattgtgttgatcagactc
atctcttctcacaagccaatcattggtaccacaaaactatcttcaagaacggtcatcctt
attaagaacatatcggtttcttcagcgcctgctatccactacgcagctgctttgaagggc
ctgagtactgctctggagagtattctgcgtaggcttttccgtgatagttcccaagttcat
tctcaactccacgagatatttgagggcttgtttcaggaggtccttaatgcaaacttcact
gaaccattaattatttcagcgcacgttgagtatctaaacgcaatggttcctatcatcaag
tcctctccagatgcggttgggagtgttatcgacaagatgtttgcacttctcacctctctt
ccaccagcatctaaacgtgcaagattatacatctgcttatctttgacgcgtttagccaaa
gctgctgacaaaagctttactcctcacttgaagggtctagctgataagatgacacgtttg
cagagagaaggagctttcctccctggtgagcacagcagtcttgtggaagcattttttgct
atgacttctgcgtcaggagctcagacgcagcagcaagacagttttgctttgttactagaa
ccagtgcgcgaacaatggactcaaccagagtggcaaaacgaatacttatctactccctct
ggttttattcagttatgctccaacgcacccttgatgcagtctattgtcaacacggtcgcc
gtcttcaagcaggctctcacgggatgcactttcaagaaaaggaagttgaacatgtctgag
acgattcatcctctggcttgtcacctttcttggatgcttccacctctcctgaagctcttt
cgtgttatcaactctctgtcttctcctgctgtttatcaaactttgcccacaaaactccaa
acagcaatgaagatagcagaagccgagttacgtagcgacaaaggaaaccaaagccgtaaa
ctaactaaagccttgtttacttgctctagtggagggaacgcaaatgatattcggaactgg
ctgagagctattcgcgataccgggtaccgtgtactgaatctctctgtagccatgggagag
acgttctacacatccatcgatgctaacgaagttgcagcggcattcactgagaatatatgt
tggatggagttcagacatataaagctgcttattaactccttcgtaggccctcttgtcata
tcctgtcctgcagataagtgggagtcattgcttgaaccgcttctaagtcctttactgacg
cactgtcagcgagctcttgactcctcgtggactagtcttctgcgcgaaggcagggccaat
gttccagatctgcgcagttttgaaggtggtgagacgaagctcatacaactggaaagacag
ctgctcatagatttatctcggtccacttcggatttgctctcaaagatctctgctcctgag
ttaaacacagggcttcctagtttgatgaagcactcagaccaacttgttcatggtgaaacg
tctcttctcaaggattttgattcactcaaatccaactctttggtgagcttactcttgagt
tgcagagacttggcagactcagtaatgcagttttctttacaagcatgcacatggagagat
ggtattacaactttcaacctccgttgttttttcattagcgttattcaactagccataaca
acaaacaacggagagctcagagagtttgtggcaaaagatttgtttaacgcactcatcatg
agcttgaccatcgatgagaatgtgaataacagttccgttttagttggtctgtgcagtgaa
atatttgtttacctttccccgagacacccagctccacgtcaggtgttgctgtcactccct
tgtctgactcctgatgatctgcgtgaatatgaaaaggctttggcagaaacttctgaaccc
aaaaaacagaagcagattacaagaagcatgttgtcattagctcttggaattaatataaaa
actgattag

DBGET integrated database retrieval system